Recombinant Bovine MMP9 protein(107-712aa), His-tagged
Cat.No. : | MMP9-21B |
Product Overview : | Recombinant Bovine MMP9 protein(P52176)(107-712aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | Yeast |
Tag : | His |
Protein Length : | 107-712aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 68.8 kDa |
AA Sequence : | FQTFEGELKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYGPEADIVIQFGVREHGDGYPFDGKNGLLAHAFPPGKGIQGDAHFDDEELWSLGKGVVIPTYFGNAKGAACHFPFTFEGRSYSACTTDGRSDDMLWCSTTADYDADRQFGFCPSERLYTQDGNADGKPCVFPFTFQGRTYSACTSDGRSDGYRWCATTANYDQDKLYGFCPTRVDATVTGGNAAGELCVFPFTFLGKEYSACTREGRNDGHLWCATTSNFDKDKKWGFCPDQGYSLFLVAAHEFGHALGLDHTSVPEALMYPMYRFTEEHPLHRDDVQGIQHLYGPRPEPEPRPPTTTTTTTTEPQPTAPPTVCVTGPPTARPSEGPTTGPTGPPAAGPTGPPTAGPSAAPTESPDPAEDVCNVDIFDAIAEIRNRLHFFKAGKYWRLSEGGGRRVQGPFLVKSKWPALPRKLDSAFEDPLTKKIFFFSGRQVWVYTGASLLGPRRLDKLGLGPEVAQVTGALPRPEGKVLLFSGQSFWRFDVKTQKVDPQSVTPVDQMFPGVPISTHDIFQYQEKAYFCQDHFYWRVSSQNEVNQVDYVGYVTFDLLKCPED |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | MMP9 matrix metallopeptidase 9 [ Bos taurus (cattle) ] |
Official Symbol | MMP9 |
Synonyms | MMP-9;92 kDa gelatinase;92 kDa type IV collagenase;Gelatinase B;GELB |
Gene ID | 282871 |
mRNA Refseq | NM_174744 |
Protein Refseq | NP_777169 |
UniProt ID | P52176 |
◆ Recombinant Proteins | ||
Mmp9-243R | Recombinant Active Rat MMP9 Protein, His-tagged(C-ter) | +Inquiry |
Mmp9-1188M | Recombinant Mouse MMP9 protein(Met1-Pro730) | +Inquiry |
MMP9-005H | Active Recombinant Human MMP9 Q279R Protein, His-tagged | +Inquiry |
MMP9-77H | Recombinant Human MMP9, His-tagged | +Inquiry |
MMP9-05M | Active Recombinant Mouse MMP9 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
MMP9-40H | Native Human MMP-9/Lipocalin/TIMP-1 Complex | +Inquiry |
MMP9-39H | Native Human MMP-9/Lipocalin Complex | +Inquiry |
MMP9-38H | Native Human MMP-9 | +Inquiry |
MMP9-30035TH | Native Human MMP9 | +Inquiry |
MMP9-41H | Native Human MMP-9/TIMP-1 Complex | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP9-2026MCL | Recombinant Mouse MMP9 cell lysate | +Inquiry |
MMP9-2560HCL | Recombinant Human MMP9 cell lysate | +Inquiry |
MMP9-1940RCL | Recombinant Rat MMP9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MMP9 Products
Required fields are marked with *
My Review for All MMP9 Products
Required fields are marked with *
0
Inquiry Basket