Recombinant Bovine INHA Protein (227-360 aa), His-SUMO-tagged

• Cat.No.: INHA-582B
• Product Overview: Recombinant Bovine INHA Protein (227-360 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Bovine
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 227-360 aa
• Description: Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, bryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 30.6 kDa
• AA Sequence: STPPLPWPWSPAALRLLQRPPEEPAAHADCHRAALNISFQELGWDRWIVHPPSFIFYYCHGGCGLSPPQDLPLPVPGVPPTPVQPLSLVPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYEMVPNLLTQHCACI
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: INHA inhibin subunit alpha [ Bos taurus (cattle) ]
• Official Symbol: INHA
• Gene ID: 281254
• mRNA Refseq: NM_174094
• Protein Refseq: NP_776519
• UniProt ID: P07994