Recombinant Bovine IFNAG Protein (24-189 aa), His-tagged
Cat.No. : | IFNAG-1852B |
Product Overview : | Recombinant Bovine IFNAG Protein (24-189 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | Yeast |
Tag : | His |
Protein Length : | 24-189 aa |
Description : | Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 21.2 kDa |
AA Sequence : | CHLPHTHSLANRRVLTLLRQLRRVSPSSCLQDRNDFAFPQEALGGSQLQKAQAISVLHEVTQHTFQFFSVEGSAVVWDESLLDKLRDALDQQLTDLQFCLRQEEGLRGAPLLKEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTNLQERFRRKD |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Synonyms | IFNAG; IFN-alpha7; |
UniProt ID | P49877 |
◆ Recombinant Proteins | ||
IFNAG-1805B | Recombinant Bovine IFNAG Protein (24-189 aa), His-SUMO-tagged | +Inquiry |
IFNAG-1852B | Recombinant Bovine IFNAG Protein (24-189 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNAG Products
Required fields are marked with *
My Review for All IFNAG Products
Required fields are marked with *
0
Inquiry Basket