Recombinant Bovine IFNAG Protein (24-189 aa), His-SUMO-tagged

• Cat.No.: IFNAG-1805B
• Product Overview: Recombinant Bovine IFNAG Protein (24-189 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length of Mature Protein.

Specification

• Species: Bovine
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 24-189 aa
• Description: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 35.2 kDa
• AA Sequence: CHLPHTHSLANRRVLTLLRQLRRVSPSSCLQDRNDFAFPQEALGGSQLQKAQAISVLHEVTQHTFQFFSVEGSAVVWDESLLDKLRDALDQQLTDLQFCLRQEEGLRGAPLLKEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTNLQERFRRKD
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: IFNAG interferon alpha G [ Bos taurus (cattle) ]
• Official Symbol: IFNAG
• Synonyms: IFNAG; IFN-alpha7
• Gene ID: 100329206
• mRNA Refseq: NM_001172040
• Protein Refseq: NP_001165511
• UniProt ID: P49877