Recombinant Arabidopsis Thaliana DRB5 Protein (1-393 aa), His-tagged

• Cat.No.: DRB5-1841A
• Product Overview: Recombinant Arabidopsis Thaliana (Mouse-ear cress) DRB5 Protein (1-393 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length.

Specification

• Species: Arabidopsis Thaliana
• Source: Yeast
• Tag: His
• ProteinLength: 1-393 aa
• Description: Binds double-stranded RNA. May be involved in RNA-mediated silencing.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 45.6 kDa
• AA Sequence: MYKNQLQELAQRSCFNLPSYTCIREGPDHAPRFKASVNFNGEIFESPTYCSTLRQAEHAAAEVSLNVLSSRVPSKSLTAKILDETGIYKNLLQETAHRAGLDLPMYTSVRSGSCHFPGFSCTVELAGMTFTGESAKTKKQAEKNAAIAAWSSLKKMSSLDSQDEEKEQEAVARVLSRFKPKEVRRRETTNQWRRRTSQQDSNKDLLIERLRWINLLTNQASSSSSTSTPNQHKNSSFISLIPPPPPPKSSKILPFIQQYKDRSSQEAKTETATEMINSKAKVNETSTRLSKQMPFSDMNRYNFVGGCSVNPYSLAPAVQMRSVIPVFAAPPPKPNPNLNPSSLSSSVNEFTSSNNSCSVLNTPGLGGQEKKNLTREMIKLGSESRILDQTHDS
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: DRB5 dsRNA-binding protein 5 [ Arabidopsis thaliana (thale cress) ]
• Official Symbol: DRB5
• Synonyms: dsRNA-binding protein 5; MEE6.14; MEE6_14
• Gene ID: 834109
• mRNA Refseq: NM_123472
• Protein Refseq: NP_198923
• UniProt ID: Q8GY79