Recombinant Full Length Arabidopsis Thaliana Cytochrome P450 72C1(Cyp72C1) Protein, His-Tagged
Cat.No. : | RFL12901AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Cytochrome P450 72C1(CYP72C1) Protein (Q9SHG5) (1-519aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-519) |
Form : | Lyophilized powder |
AA Sequence : | MLEIITVRKVFLIGFLILILNWVWRAVNWVWLRPKRLEKYLKKQGFSGNSYRILMGDMRE SNQMDQVAHSLPLPLDADFLPRMMPFLHHTVLKHGKKCFTWYGPYPNVIVMDPETLREIM SKHELFPKPKIGSHNHVFLSGLLNHEGPKWSKHRSILNPAFRIDNLKSILPAFNSSCKEM LEEWERLASAKGTMELDSWTHCHDLTRNMLARASFGDSYKDGIKIFEIQQEQIDLGLLAI RAVYIPGSKFLPTKFNRRLRETERDMRAMFKAMIETKEEEIKRGRGTDKNSDLLFSMLAS NTKTIKEQGPDSGLSLDDLIDDCKAFYLAGQNVTSSLFVWTLVALSQHQDWQNKARDEIS QAFGNNEPDFEGLSHLKVVTMILHEVLRLYSPAYFTCRITKQEVKLERFSLPEGVVVTIP MLLVHHDSDLWGDDVKEFKPERFANGVAGATKGRLSFLPFSSGPRTCIGQNFSMLQAKLF LAMVLQRFSVELSPSYTHAPFPAATTFPQHGAHLIIRKL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CYP72C1 |
Synonyms | CYP72C1; CHI2; DLF; SHK1; SOB7; At1g17060; F20D23.24; Cytochrome P450 72C1; Protein CHIBI 2; Protein DWARFISH WITH LOW FERTILITY; Protein SHRINK 1; Protein SUPPRESSOR OF PHYB-4 PROTEIN 7 |
UniProt ID | Q9SHG5 |
◆ Recombinant Proteins | ||
Sftpd-11M | Active Recombinant Mouse Sftpd Protein | +Inquiry |
CAR3-1132R | Recombinant Rat CAR3 Protein | +Inquiry |
RFL15969FF | Recombinant Full Length Faba Bean Necrotic Yellows Virus Putative Movement Protein(Dna-M) Protein, His-Tagged | +Inquiry |
DUSP12-12205H | Recombinant Human DUSP12, His-tagged | +Inquiry |
YCZK-3521B | Recombinant Bacillus subtilis YCZK protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CASQ2-30C | Native Canine CASQ2 | +Inquiry |
Fibrinogen-7589H | Native Human Fibrinogen | +Inquiry |
Lectin-1798L | Active Native Lotus Tetragonolobus Lectin Protein, Fluorescein labeled | +Inquiry |
LDL-247H | Native Human Lipoproteins, Very Low Density | +Inquiry |
Lectin-1818P | Active Native Peanut Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAGEB2-4545HCL | Recombinant Human MAGEB2 293 Cell Lysate | +Inquiry |
ITGB1-5128HCL | Recombinant Human ITGB1 293 Cell Lysate | +Inquiry |
Adipose-129R | Rat Adipose Tissue Lysate | +Inquiry |
DCN-2274HCL | Recombinant Human DCN cell lysate | +Inquiry |
CD247-7679HCL | Recombinant Human CD247 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP72C1 Products
Required fields are marked with *
My Review for All CYP72C1 Products
Required fields are marked with *
0
Inquiry Basket