Recombinant ALT protein, His-tagged
| Cat.No. : | ALT-116 |
| Product Overview : | Recombinant ALT was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E.coli |
| Tag : | His |
| AA Sequence : | MNKVLIIFGLVILLVTPLRAQEEDEMDDDEEFDGEDEGNDDSSSEGGDDGGDDSNDGGSNGGEDSEYVTKGKFVE TDGKKKQCNSHEACYDQREPQAWCILKKGQSWTNKGCFCEEKMNSCVIERKNGGNLEYAYCAPQEGWQCSYDZ |
| ◆ Recombinant Proteins | ||
| S100A8-4874R | Recombinant Rat S100A8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FGF5-28880TH | Recombinant Human FGF5 | +Inquiry |
| Tnf-495M | Active Recombinant Mouse Tnf Protein, His-Avi-tagged, Biotinylated | +Inquiry |
| NOLC1-5982H | Recombinant Human NOLC1 Protein, GST-tagged | +Inquiry |
| Fhod1-3014M | Recombinant Mouse Fhod1 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Native Proteins | ||
| HRP-8336h | Active Native horseradish HRP | +Inquiry |
| GSN-875B | Active Native Bovine GSN Protein | +Inquiry |
| TTR-706H | Native Human Transthyretin | +Inquiry |
| IgG-013L | Native Llama IgG, Protein G Purified | +Inquiry |
| PLG-30083TH | Native Human PLG | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| JDP2-5104HCL | Recombinant Human JDP2 293 Cell Lysate | +Inquiry |
| UBE2L6-569HCL | Recombinant Human UBE2L6 293 Cell Lysate | +Inquiry |
| MACROD2-4571HCL | Recombinant Human MACROD2 293 Cell Lysate | +Inquiry |
| DYNC1LI1-6762HCL | Recombinant Human DYNC1LI1 293 Cell Lysate | +Inquiry |
| IL2RG-502HCL | Recombinant Human IL2RG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALT Products
Required fields are marked with *
My Review for All ALT Products
Required fields are marked with *
0
Inquiry Basket
