Recombinant Active Mouse IL1RN Protein, His-tagged(C-ter)

• Cat.No.: Il1rn-168M
• Product Overview: Recombinant Active Mouse IL1RN Protein with His tag (C-ter) was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: The protein encoded by this gene is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses. This gene and five other closely related cytokine genes form a gene cluster spanning approximately 400 kb on chromosome 2. A polymorphism of this gene is reported to be associated with increased risk of osteoporotic fractures and gastric cancer. Four alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
• Form: Powder
• Bio-activity: Determined by its ability to inhibit IL-1 alpha-dependent proliferation in D10.G4.1 cells. The ED50 for this effect is < 50 ng/mL.
• AA Sequence: MRPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ
• Endotoxin: Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
• Purity: > 98% (by SDS-PAGE)
• Applications: SDS-PAGE
• Notes: For laboratory research only, not for drug, diagnostic or other use.
• Storage: Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
• Storage Buffer: PBS (pH 7.4)
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Information

• Gene Name: Il1rn interleukin 1 receptor antagonist [ Mus musculus ]
• Official Symbol: Il1rn
• Synonyms: IL1RN; interleukin 1 receptor antagonist; interleukin-1 receptor antagonist protein; IRAP; IL-1RN; IL1 inhibitor; IL-1ra; F630041P17Rik
• Gene ID: 16181
• mRNA Refseq: NM_001039701
• Protein Refseq: NP_001034790