Recombinant Cynomolgus IL1RN Protein, His-tagged
Cat.No. : | IL1RN-10C |
Product Overview : | Recombinant Cynomolgus IL1RN Protein, fused to His-tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cynomolgus |
Source : | HEK293 |
Tag : | His |
Description : | Protein coding |
Form : | PBS, pH 7.4 |
Molecular Mass : | 17.9 kDa |
AA Sequence : | RPSGRKPSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSKNRKQDKRFAFVRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDKGVMVTKFYFQEDEHHHHHH |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.85 mg/ml |
Gene Name | IL1RN interleukin 1 receptor antagonist [ Macaca mulatta (Rhesus monkey) ] |
Official Symbol | IL1RN |
Synonyms | DIRA; IRAP; IL1F3; IL1RA; MVCD4; IL-1RN; IL-1ra; IL-1ra3; ICIL-1RA |
Gene ID | 701658 |
mRNA Refseq | XM_015113137 |
Protein Refseq | XP_014968623 |
UniProt ID | F7HP64 |
◆ Recombinant Proteins | ||
IL1RN-188H | Active Recombinant Human IL1RN protein(Arg26-Glu177) | +Inquiry |
Il1rn-574R | Recombinant Rat Il1rn protein | +Inquiry |
IL1RN-1171H | Recombinant Human IL1RN Protein, His (Fc)-Avi-tagged | +Inquiry |
IL1RN-183I | Active Recombinant Human IL1RN Protein | +Inquiry |
IL1RN-153H | Active Recombinant Human IL1RN Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1RN-2912HCL | Recombinant Human IL1RN cell lysate | +Inquiry |
IL1RN-1375RCL | Recombinant Rat IL1RN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL1RN Products
Required fields are marked with *
My Review for All IL1RN Products
Required fields are marked with *
0
Inquiry Basket