Recombinant Cynomolgus IL1RN Protein, His-tagged

Cat.No. : IL1RN-10C
Product Overview : Recombinant Cynomolgus IL1RN Protein, fused to His-tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Cynomolgus
Source : HEK293
Tag : His
Description : Protein coding
Form : PBS, pH 7.4
Molecular Mass : 17.9 kDa
AA Sequence : RPSGRKPSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSKNRKQDKRFAFVRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDKGVMVTKFYFQEDEHHHHHH
Purity : >90%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.85 mg/ml
Gene Name IL1RN interleukin 1 receptor antagonist [ Macaca mulatta (Rhesus monkey) ]
Official Symbol IL1RN
Synonyms DIRA; IRAP; IL1F3; IL1RA; MVCD4; IL-1RN; IL-1ra; IL-1ra3; ICIL-1RA
Gene ID 701658
mRNA Refseq XM_015113137
Protein Refseq XP_014968623
UniProt ID F7HP64

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IL1RN Products

Required fields are marked with *

My Review for All IL1RN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon