Active Recombinant Human IL1RN Protein (153 aa)

• Cat.No.: IL1RN-103I
• Product Overview: Recombinant Human IL1RN Protein without tag was expressed in E. coli.

Specification

• Description: Interleukin-1 receptor antagonist (IL-1ra) is a member of the IL-1 family. Endogenous IL-1ra is produced in numerous animal disease models as well as in human autoimmune and chronic inflammatory diseases. It binds to IL-1 receptors in competition with IL-1, but does not elicit intracellular response from this binding. Its role in counteracting the proinflammatory effects of IL-1 is being studied by numerous research groups. IL-4 and IL-13 have been shown to amplify the stimulatory effect of IL1-beta on the production of soluble and intracellular forms of IL1-ra.The regulated expression of IL1ra in various cell types has been shown to be influenced by cytokines. In synovial fibroblasts the synthesis of IL-1ra is markedly enhanced by IL-1, TNF-alpha, or PDGF.
• Source: E. coli
• Species: Human
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant inhibition of IL-1 stimulation of D10S cells was found to be 0.5 ng/mL, corresponding to a Specific Activity of ＞2.0 × 10^6 IU/mg.
• Molecular Mass: Approximately 17.0 kDa, a single non-glycosylated polypeptide chain containing 153 amino acids.
• Protein length: 153
• AA Sequence: MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
• Endotoxin: Less than 1 EU/μg of rHuIL-1ra as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: IL1RN interleukin 1 receptor antagonist [ Homo sapiens ]
• Official Symbol: IL1RN
• Synonyms: IL1RN; interleukin 1 receptor antagonist; interleukin-1 receptor antagonist protein; ICIL 1RA; IL 1RN; IL1F3; IL1RA; interleukin 1 receptor antagonist protein; intracellular interleukin 1 receptor antagonist; IRAP; MGC10430; IL1 inhibitor; IL1RN (IL1F3); type II interleukin-1 receptor antagonist; intracellular IL-1 receptor antagonist type II; intracellular interleukin-1 receptor antagonist (icIL-1ra); DIRA; MVCD4; IL-1RN; IL-1ra; IL-1ra3; ICIL-1RA
• Gene ID: 3557
• mRNA Refseq: NM_000577
• Protein Refseq: NP_000568
• MIM: 147679
• UniProt ID: P18510