Recombinant Human LGALS4 Protein, His-tagged
Cat.No. : | LGALS4-262H |
Product Overview : | Recombinant human LGALS4 protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The expression of this gene is restricted to small intestine, colon, and rectum, and it is underexpressed in colorectal cancer. |
Source : | HEK293 |
Species : | Human |
Tag : | His |
Form : | Lyophilized |
Molecular Mass : | 38.1 kDa |
Protein length : | 323 |
AA Sequence : | MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | LGALS4 lectin, galactoside-binding, soluble, 4 [ Homo sapiens (human) ] |
Official Symbol | LGALS4 |
Synonyms | LGALS4; lectin, galactoside-binding, soluble, 4; galectin-4; GAL4; galectin 4; gal-4; antigen NY-CO-27; lactose-binding lectin 4; L-36 lactose-binding protein; L36LBP; |
Gene ID | 3960 |
mRNA Refseq | NM_006149 |
Protein Refseq | NP_006140 |
MIM | 602518 |
UniProt ID | P56470 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All LGALS4 Products
Required fields are marked with *
My Review for All LGALS4 Products
Required fields are marked with *
0
Inquiry Basket