Recombinant Human LGALS4 Protein, His-tagged

Cat.No. : LGALS4-262H
Product Overview : Recombinant human LGALS4 protein with His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 323
Description : The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The expression of this gene is restricted to small intestine, colon, and rectum, and it is underexpressed in colorectal cancer.
Form : Lyophilized
Molecular Mass : 38.1 kDa
AA Sequence : MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name LGALS4 lectin, galactoside-binding, soluble, 4 [ Homo sapiens (human) ]
Official Symbol LGALS4
Synonyms LGALS4; lectin, galactoside-binding, soluble, 4; galectin-4; GAL4; galectin 4; gal-4; antigen NY-CO-27; lactose-binding lectin 4; L-36 lactose-binding protein; L36LBP;
Gene ID 3960
mRNA Refseq NM_006149
Protein Refseq NP_006140
MIM 602518
UniProt ID P56470

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LGALS4 Products

Required fields are marked with *

My Review for All LGALS4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon