Recombinant Human LGALS4 Protein, His-tagged

• Cat.No.: LGALS4-262H
• Product Overview: Recombinant human LGALS4 protein with His tag was expressed in HEK293.

Specification

• Description: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The expression of this gene is restricted to small intestine, colon, and rectum, and it is underexpressed in colorectal cancer.
• Source: HEK293
• Species: Human
• Tag: His
• Form: Lyophilized
• Molecular Mass: 38.1 kDa
• Protein length: 323
• AA Sequence: MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: LGALS4 lectin, galactoside-binding, soluble, 4 [ Homo sapiens (human) ]
• Official Symbol: LGALS4
• Synonyms: LGALS4; lectin, galactoside-binding, soluble, 4; galectin-4; GAL4; galectin 4; gal-4; antigen NY-CO-27; lactose-binding lectin 4; L-36 lactose-binding protein; L36LBP
• Gene ID: 3960
• mRNA Refseq: NM_006149
• Protein Refseq: NP_006140
• MIM: 602518
• UniProt ID: P56470