Recombinant Active Human LGALS3 Protein, His-tagged(N-ter)

• Cat.No.: LGALS3-228H
• Product Overview: Recombinant Active Human LGALS3 Protein with His tag (N-ter) was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Oct 2014]
• Form: Powder
• Bio-activity: Measured by its ability to agglutinate human red blood cells. The ED50 for this effect is < 8 μg/mL.
• AA Sequence: ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
• Endotoxin: Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
• Purity: > 95% (by SDS-PAGE)
• Applications: SDS-PAGE
• Notes: For laboratory research only, not for drug, diagnostic or other use.
• Storage: Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
• Storage Buffer: PBS (pH 7.4)
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Information

• Gene Name: LGALS3 lectin, galactoside-binding, soluble, 3 [ Homo sapiens ]
• Official Symbol: LGALS3
• Synonyms: LGALS3; lectin, galactoside-binding, soluble, 3; LGALS2; galectin-3; galectin 3; GALIG; MAC 2; lectin L-29; 35 kDa lectin; MAC-2 antigen; IgE-binding protein; laminin-binding protein; galactose-specific lectin 3; carbohydrate-binding protein 35; L31; GAL3; MAC2; CBP35; GALBP
• Gene ID: 3958
• mRNA Refseq: NM_001177388
• Protein Refseq: NP_001170859
• MIM: 153619
• UniProt ID: P17931