Recombinant Active Human IL36A Protein, His-tagged(C-ter)

• Cat.No.: IL36A-195H
• Product Overview: Recombinant Active Human IL36A Protein with His tag (C-ter) was expressed in E. coli.

Specification

• Description: The protein encoded by this gene is a cytokine that can activate NF-kappa-B and MAPK signaling pathways to generate an inflammatory response. The encoded protein functions primarily in skin and demonstrates increased expression in psoriasis. In addition, decreased expression of this gene has been linked to a poor prognosis in both hepatocellular carcinoma and colorectal cancer patients.
• Source: E. coli
• Species: Human
• Tag: His
• Form: Powder
• Bio-activity: Determined by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is < 0.7 ng/mL.
• AA Sequence: MKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF
• Endotoxin: Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
• Purity: > 98% (by SDS-PAGE)
• Applications: SDS-PAGE
• Notes: For laboratory research only, not for drug, diagnostic or other use.
• Storage: Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
• Storage Buffer: PBS (pH 7.4)
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Information

• Gene Name: IL36A interleukin 36, alpha [ Homo sapiens ]
• Official Symbol: IL36A
• Synonyms: IL36A; interleukin 36, alpha; IL1F6, interleukin 1 family, member 6 (epsilon); interleukin-36 alpha; FIL1; FIL1E; IL 1F6; IL1(EPSILON); MGC129552; MGC129553; FIL1 epsilon; IL-1 epsilon; interleukin-1 epsilon; IL-1F6 (FIL-1-epsilon); interleukin 1, epsilon; interleukin-1 family member 6; interleukin 1 family, member 6 (epsilon); IL1F6; IL-1F6; FIL1(EPSILON)
• Gene ID: 27179
• mRNA Refseq: NM_014440
• Protein Refseq: NP_055255
• MIM: 605509
• UniProt ID: Q9UHA7