Recombinant Active Human IL20 Protein, His-tagged(C-ter)

• Cat.No.: IL20-172H
• Product Overview: Recombinant Active Human IL20 Protein with His tag (C-ter) was expressed in E. coli.

Specification

• Description: The protein encoded by this gene is a cytokine structurally related to interleukin 10 (IL10). This cytokine has been shown to transduce its signal through signal transducer and activator of transcription 3 (STAT3) in keratinocytes. A specific receptor for this cytokine is found to be expressed in skin and upregulated dramatically in psoriatic skin, suggesting a role for this protein in epidermal function and psoriasis. [provided by RefSeq, Jul 2008]
• Source: E. coli
• Species: Human
• Tag: His
• Form: Powder
• Bio-activity: Determined by its ability to chemoattract BaF3 mouse pro-B cells transfected with human IL-20R alpha and IL-20R beta. The ED50 for this effect is < 0.2 ng/mL.
• AA Sequence: MLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
• Endotoxin: Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
• Purity: > 98% (by SDS-PAGE)
• Applications: SDS-PAGE
• Notes: For laboratory research only, not for drug, diagnostic or other use.
• Storage: Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
• Storage Buffer: PBS (pH 8.0)
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Information

• Gene Name: IL20 interleukin 20 [ Homo sapiens ]
• Official Symbol: IL20
• Synonyms: IL20; interleukin 20; interleukin-20; IL 20; IL10D; ZCYTO10; cytokine Zcyto10; four alpha helix cytokine; IL-20; MGC96907
• Gene ID: 50604
• mRNA Refseq: NM_018724
• Protein Refseq: NP_061194
• MIM: 605619
• UniProt ID: Q9NYY1