Active Recombinant Mouse Il20 Protein, His-Tagged

• Cat.No.: Il20-01M
• Product Overview: Recombinant mouse Il20 Protein, His-tagged was expressed in E. coli cell

Specification

• Description: Interleukin 20 (IL20) is a cytokine structurally related to interleukin 10 (IL-10). This cytokine has been shown to transduce its signal through signal transducer and activator of transcription 3 (STAT3) in keratinocytes. A specific receptor for this cytokine is found to be expressed in skin and upregulated dramatically in psoriatic skin, suggesting a role for this protein in epidermal function and psoriasis.
• Source: Escherichia coli
• Species: Mouse
• Tag: His
• Form: Lyophilized powder
• AA Sequence: MLKTLHLGSCVITANLQAIQKEFSEIRDSVQAEDTNIDIRILRTTESLKDIKSLDRCCFLRHLVRFYLDRVFKVYQTPDHHTLRKISSLANSFLIIKK
  DLSVCHSHMACHCGEEAMEKYNQILSHFIELELQAAVVKALGELGILLRWMEEML with polyhistidine tag at the C-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Bio-activity: Measure by its ability to induce proliferation in BaF3 cells transfected with human IL-20 R alpha and human IL-20 R beta. The ED50 for this effect is <2 ng/mL.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Notes: Please use within one month after protein reconstitution.

Gene Information

• Gene Name: Il20 interleukin 20 [ Mus musculus (house mouse) ]
• Official Symbol: Il20
• Synonyms: If2d; Zcyto10
• Gene ID: 58181
• mRNA Refseq: NM_001311091.1
• Protein Refseq: NP_001298020.1
• UniProt ID: Q9JKV9