Recombinant Active Human IL1B Protein, His-tagged(C-ter)

• Cat.No.: IL1B-162H
• Product Overview: Recombinant Active Human IL1B Protein with His tag (C-ter) was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: IL1 beta protein is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. [provided by RefSeq, Jul 2008]
• Form: Powder
• Bio-activity: Determined by its ability to induce proliferation in D10.G4.1 cells. The ED50 for this effect is <10 pg/mL. The specific activity of recombinant human IL-1 beta is approximately >1.5 x 10^8 IU/mg. Determined by its ability to induce IL-8 secretion in HT29 cells. The ED50 for this effect is 1.8-5.1 ng/mL.
• AA Sequence: MASAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
• Endotoxin: Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
• Purity: > 98% (by SDS-PAGE)
• Applications: SDS-PAGE
• Notes: For laboratory research only, not for drug, diagnostic or other use.
• Storage: Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
• Storage Buffer: PBS (pH 8.0)
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Information

• Gene Name: IL1B interleukin 1, beta [ Homo sapiens ]
• Official Symbol: IL1B
• Synonyms: IL1B; interleukin 1, beta; interleukin-1 beta; IL 1B; IL1 BETA; IL1F2; IL-1 beta; catabolin; preinterleukin 1 beta; pro-interleukin-1-beta; IL-1; IL1-BETA
• Gene ID: 3553
• mRNA Refseq: NM_000576
• Protein Refseq: NP_000567
• MIM: 147720
• UniProt ID: P01584