Active Recombinant Pig IL1B Protein (154 aa)

• Cat.No.: IL1B-364I
• Product Overview: Recombinant Porcine IL-1β produced in E. coli is a single non-glycosylated polypeptide chain containing 154 amino acids. A fully biologically active molecule, rpIL-1β has a molecular mass of 17.7 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.

Specification

• Species: Pig
• Source: E.coli
• Protein Length: 154
• Description: Interleukin-1 beta (rpIL-1β) is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. IL-1α and IL-1β are structurally related polypeptides that share approximately 27% amino acid (aa) identity in porcine. While IL-1α and IL-1β are regulated independently, they bind to the same receptor and exert identical biological effects. IL-1β stimulates thymocyte proliferation by inducing il-2 release, b-cell maturation and proliferation, and fibroblast growth factor activity.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 1 ng/mL, measured by the dose-dependent stimulation of mouse D10S cells, corresponding to a specific activity of 1.0 × 10^6 IU/mg.
• Molecular Mass: 17.7 kDa, observed by reducing SDS-PAGE.
• AA Sequence: MANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant Porcine IL-1β, remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Porcine IL-1β should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: IL1B interleukin 1, beta [ Sus scrofa ]
• Official Symbol: IL1B
• Synonyms: IL1B; interleukin 1, beta; interleukin-1 beta; IL-1 beta; prointerleukin-1 beta
• Gene ID: 397122
• mRNA Refseq: NM_214055
• Protein Refseq: NP_999220
• UniProt ID: P26889