Active Recombinant Mouse Il1b Protein

• Cat.No.: Il1b-100M
• Product Overview: Purified recombinant protein of Mouse interleukin 1 beta (Il1b) without tag was expressed in E.coli.

Specification

• Description: The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1. The encoded protein plays a role in thymocyte proliferation and is involved in the inflammatory response.
• Source: E. coli
• Species: Mouse
• Bio-activity: The ED50 as determined by the dose-dependent stimulation of murine D10S cells is less than or equal to 0.002 ng/ml, corresponding to a specific activity of > 5 x 10^8 units/mg.
• Molecular Mass: 17.5 kDa
• AA Sequence: MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Il1b interleukin 1 beta [ Mus musculus (house mouse) ]
• Official Symbol: Il1b
• Synonyms: Il1b; interleukin 1 beta; Il-1b; IL-1beta; interleukin-1 beta; IL-1 beta
• Gene ID: 16176
• mRNA Refseq: NM_008361
• Protein Refseq: NP_032387
• UniProt ID: P10749