Recombinant Active Human IGF1 Protein, His-tagged(C-ter)

• Cat.No.: IGF1-127H
• Product Overview: Recombinant Active Human IGF1 Protein with His tag (C-ter) was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and secreted. Defects in this gene are a cause of insulin-like growth factor I deficiency. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein. [provided by RefSeq, Sep 2015]
• Form: Powder
• Bio-activity: Determined by its ability to induce MCF-7 cells proliferation. The ED50 for this effect is 0.9-3.1 ng/mL. The specific activity of recombinant human IGF-I is approximately > 1.2 x 10^3 IU/mg.
• AA Sequence: MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
• Endotoxin: Endotoxin level is less than 0.01 EU/μg of the protein, as determined by the LAL test.
• Purity: > 95% (by SDS-PAGE)
• Applications: SDS-PAGE
• Notes: For laboratory research only, not for drug, diagnostic or other use.
• Storage: Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
• Storage Buffer: PBS (pH 7.4)
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Information

• Gene Name: IGF1 insulin-like growth factor 1 (somatomedin C) [ Homo sapiens ]
• Official Symbol: IGF1
• Synonyms: IGF1; insulin-like growth factor 1 (somatomedin C); insulin-like growth factor 1; IGF1A; MGF; IGF-IA; IGF-IB; somatomedin-C; mechano growth factor; insulin-like growth factor I; insulin-like growth factor IA; insulin-like growth factor IB; IGFI; IGF-I
• Gene ID: 3479
• mRNA Refseq: NM_000618
• Protein Refseq: NP_000609
• MIM: 147440
• UniProt ID: P05019