Recombinant Active Human HMGB1 Protein, His-tagged(C-ter)

• Cat.No.: HMGB1-116H
• Product Overview: Recombinant Active Human HMGB1 Protein with His tag (C-ter) was expressed in E. coli.

Specification

• Product Overview: Recombinant Active Human HMGB1 Protein with His tag (C-ter) was expressed in E. coli.
• Description: HMGB1 is a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2015]
• Source: E. coli
• Species: Human
• Tag: His
• Form: Powder
• Bio-activity: Measure by its ability to induce TNF alpha in Raw264.7 cells.
  The ED50 for this effect is < 10 μg/mL. This protein also induces TNF alpha releasing from human A549 cultured cells based on customer feedback.
• AA Sequence: MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
• Endotoxin: Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
• Purity: > 98% (by SDS-PAGE)
• Applications: FuncSt, SDS-PAGE
• Notes: For laboratory research only, not for drug, diagnostic or other use.
• Storage: Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
• Storage Buffer: PBS (pH 8.0)
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Information

• Gene Name: HMGB1 high mobility group box 1 [ Homo sapiens ]
• Official Symbol: HMGB1
• Synonyms: HMGB1; high mobility group box 1; high mobility group (nonhistone chromosomal) protein 1 , high mobility group box 1 , HMG1; high mobility group protein B1; Amphoterin; DKFZp686A04236; high mobility group protein 1; HMG3; SBP 1; Sulfoglucuronyl carbohydrate binding protein; HMG-1; high-mobility group box 1; high-mobility group (nonhistone chromosomal) protein 1; HMG1; SBP-1
• Gene ID: 3146
• mRNA Refseq: NM_002128
• Protein Refseq: NP_002119
• MIM: 163905
• UniProt ID: P09429