Recombinant Active Human D2HGDH Protein, His-tagged, Animal Free

• Cat.No.: D2HGDH-02H
• Product Overview: Recombinant Active Full length Human D2HGDH Protein (Animal free) with His tag C-Terminus was expressed in E. coli.

Specification

• Description: This gene encodes D-2hydroxyglutarate dehydrogenase, a mitochondrial enzyme belonging to the FAD-binding oxidoreductase/transferase type 4 family. This enzyme, which is most active in liver and kidney but also active in heart and brain, converts D-2-hydroxyglutarate to 2-ketoglutarate. Mutations in this gene are present in D-2-hydroxyglutaric aciduria, a rare recessive neurometabolic disorder causing developmental delay, epilepsy, hypotonia, and dysmorphic features.
• Source: E. coli
• Species: Human
• Tag: His tag C-Terminus
• Form: Lyophilized
• Bio-activity: The specific activity of D2HGDH is ≥ 90,000 mU/mg.
• Molecular Mass: 39 kDa
• AA Sequence: MKVLCYGVRDVELPIFEACNKEFGYDIKCVPDYLNTKETAEMAAGFDAVILRGNCFANKQNLDIYKKLGVKYILTRTAGTDHIDKEYAKELGFPMAFVPRYSPNAIAELAVTQAMMLLRHTAYTTSRTAKKNFKVDAFMFSKEVRNCTVGVVGLGRIGRVAAQIFHGMGATVIGEDVFEIKGIEDYCTQVSLDEVLEKSDIITIHAPYIKENGAVVTRDFLKKMKDGAILVNCARGQLVDTEAVIEAVESGKLGGYGCDVLDGEASVFGKDLEGQKLENPLFEKLVDLYPRVLITPHLGSYTDEAVKNMVEVSYQNLKDLAETGDCPNKIKMGSSHHHHHHSSGLVPRGSHM
• Purity: ≥ 99% SDS-PAGE
• Applications: Functional Studies, SDS-PAGE
• Storage: Shipped at 4 centigrade. Store at +4 centigrade short term (1-2 weeks). Store at -20 centigrade. Avoid freeze/thaw cycle.
  This product is an active protein and may elicit a biological response in vivo, handle with caution.
• Reconstitution: Reconstitute in water to a concentration of 0.1-5 mg/mL. The solution can be diluted into other aqueous buffers and stored at –20 centigrade for future use.
• Full Length: Full L.

Gene Information

• Gene Name: D2HGDH D-2-hydroxyglutarate dehydrogenase [ Homo sapiens (human) ]
• Official Symbol: D2HGDH
• Synonyms: D2HGDH; D-2-hydroxyglutarate dehydrogenase; D2HGD; D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39
• Gene ID: 728294
• mRNA Refseq: NM_152783
• Protein Refseq: NP_689996
• MIM: 609186
• UniProt ID: D2RJU7