Recombinant Human BMPR1A protein, His-tagged

• Cat.No.: BMPR1A-2876H
• Product Overview: Recombinant Human BMPR1A protein(174-427 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 174-427 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: FCYKHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKNHFQPYIM
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: BMPR1A bone morphogenetic protein receptor, type IA [ Homo sapiens ]
• Official Symbol: BMPR1A
• Synonyms: BMPR1A; bone morphogenetic protein receptor, type IA; ACVRLK3; bone morphogenetic protein receptor type-1A; ALK3; CD292; ALK-3; BMPR-1A; BMP type-1A receptor; activin receptor-like kinase 3; activin A receptor, type II-like kinase 3; serine/threonine-protein kinase receptor R5; SKR5; 10q23del
• Gene ID: 657
• mRNA Refseq: NM_004329
• Protein Refseq: NP_004320
• MIM: 601299
• UniProt ID: P36894