Recombinant A. thaliana OSM34 Protein, His-SUMO/MYC-tagged
Cat.No. : | OSM34-1313H |
Product Overview : | Recombinant A. thaliana OSM34 Protein (23-244aa) was expressed in E. coli with N-terminal His-SUMO tag and C-terminal MYC tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | A.thaliana |
Source : | E.coli |
Tag : | His&Myc&SUMO |
ProteinLength : | 23-244 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 44.4 kDa |
AA Sequence : | ATFEILNQCSYTVWAAASPGGGRRLDAGQSWRLDVAAGTKMARIWGRTNCNFDSSGRGRCQTGDCSGGLQ CTGWGQPPNTLAEYALNQFNNLDFYDISLVDGFNIPMEFSPTSSNCHRILCTADINGQCPNVLRAPGGCN NPCTVFQTNQYCCTNGQGSCSDTEYSRFFKQRCPDAYSYPQDDPTSTFTCTNTNYRVVFCPRSRLGATGS HQLPIKMVTEEN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | OSM34 osmotin 34 [ Arabidopsis thaliana (thale cress) ] |
Official Symbol | OSM34 |
Synonyms | ATOSM34; osmotin 34; T5C23.80; T5C23_80; OSM34 |
Gene ID | 826770 |
mRNA Refseq | NM_117234.3 |
Protein Refseq | NP_192902.1 |
UniProt ID | P50700 |
◆ Recombinant Proteins | ||
TGOLN2-16721M | Recombinant Mouse TGOLN2 Protein | +Inquiry |
COL6A2-6900C | Recombinant Chicken COL6A2 | +Inquiry |
C3orf14-3720H | Recombinant Human C3orf14 protein, His-tagged | +Inquiry |
BC005537-1832M | Recombinant Mouse BC005537 Protein, Myc/DDK-tagged | +Inquiry |
RFL18800BF | Recombinant Full Length Upf0295 Protein Ba_0538/Gbaa_0538/Bas0506(Ba_0538, Gbaa_0538, Bas0506) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
AEBP1-8321S | Native S. cerevisiae AEBP1 | +Inquiry |
APOC2-27331TH | Native Human APOC2 protein | +Inquiry |
HP-7761R | Native Rabbit Haptoglobin Protein | +Inquiry |
MDH-38P | Active Native Porcine Malate dehydrogenase | +Inquiry |
IGHA1-210H | Native Human Immunoglobulin A1 (IgA1) | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRSF1-1910HCL | Recombinant Human SFRS1 293 Cell Lysate | +Inquiry |
ADAM19-9038HCL | Recombinant Human ADAM19 293 Cell Lysate | +Inquiry |
CD48-2468MCL | Recombinant Mouse CD48 cell lysate | +Inquiry |
ACVR2A-2280MCL | Recombinant Mouse ACVR2A cell lysate | +Inquiry |
SCAMP2-2049HCL | Recombinant Human SCAMP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OSM34 Products
Required fields are marked with *
My Review for All OSM34 Products
Required fields are marked with *
0
Inquiry Basket