Recombinant Full Length Upf0295 Protein Ba_0538/Gbaa_0538/Bas0506(Ba_0538, Gbaa_0538, Bas0506) Protein, His-Tagged

• Cat.No.: RFL18800BF
• Product Overview: Recombinant Full Length UPF0295 protein BA_0538/GBAA_0538/BAS0506(BA_0538, GBAA_0538, BAS0506) Protein (Q81YU3) (1-118aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Bacillus anthracis
• Source: E.coli
• Tag: His
• ProteinLength: Full Length (1-118)
• Form: Lyophilized powder
• AA Sequence: MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVYFW IGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRDLEGKEFDEKYNKKSYKS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: BA_0538
• Synonyms: BA_0538; GBAA_0538; BAS0506; UPF0295 protein BA_0538/GBAA_0538/BAS0506
• UniProt ID: Q81YU3