Species : |
Human |
Source : |
Plasma |
Tag : |
Non |
Description : |
Prolactin inducible protein (PIP) is a 17 kDa glycoprotein existing in human seminal plasma. PIP is synthesized as a 146 amino acid long polypeptide exhibiting high sequence similarity with mouse submaxillary gland with a single glycosylation site. The precise biological functions of PIP are still ambiguous but various functions have been assigned to PIP due its existence at high concentration in biological fluids. PIP binds to various proteins such as fibrinogen, actin, keratin, myosin and tropomyosin. PIP is also expressed in pathological conditions of the mammary gland and in some exocrine tissues, such as the lacrimal, salivary and sweat glands. Due to PIP's association with secretory cell differentiation, it has been used in diagnostic evaluation of tumors of breast, salivary gland, and skin. |
Form : |
Filtered White lyophilized (freeze-dried) powder. |
Molecular Mass : |
13.52 kDa |
AASequence : |
QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE |
Purity : |
Greater than 95% as determined by SDS-PAGE. |
Human Virus Test : |
Samples from each donor have been tested and found negative for HBsAg, HIV1+2, HCV, syphilis, aHBc, RRR. |
Solubility : |
It is recommended to add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. PIP is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture. |
Storage : |
Store lyophilized protein at -20 centigrade. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 centigrade for a limited period of time; it does not show any change after two weeks at 4 centigrade. |
Storage Buffer : |
PIP protein filtered (0.4 μm) and lyophilized in 0.5 mg/mL in 0.05M phosphate buffer and 0.075M NaCl pH 8.0. |
Shipping : |
Shipped at room temperature. |