Recombinant Human CLIC2, His-tagged

• Cat.No.: CLIC2-27815TH
• Product Overview: Recombinant full length Human CLIC2 with an N terminal His tag; 267 amino acids with tag, Predicted MWt 30.5 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 247 amino acids
• Description: Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 2 is a member of the p64 family; the protein is detected in fetal liver and adult skeletal muscle tissue.This gene maps to the candidate region on chromosome X for incontinentia pigmenti.
• Conjugation: HIS
• Molecular Weight: 30.500kDa inclusive of tags
• Tissue specificity: Detected in adult brain, heart, liver, lung, spleen, stomach and testis. Expressed in fetal liver and adult skeletal muscle.
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS
• Sequence Similarities: Belongs to the chloride channel CLIC family.Contains 1 GST C-terminal domain.

Gene Information

• Gene Name: CLIC2 chloride intracellular channel 2 [ Homo sapiens ]
• Official Symbol: CLIC2
• Synonyms: CLIC2; chloride intracellular channel 2; chloride intracellular channel protein 2; XAP121
• Gene ID: 1193
• mRNA Refseq: NM_001289
• Protein Refseq: NP_001280
• MIM: 300138
• Uniprot ID: O15247
• Chromosome Location: Xq28
• Function: chloride channel activity; voltage-gated chloride channel activity; voltage-gated ion channel activity