Recombinant Human CLIC2, His-tagged
Cat.No. : | CLIC2-27815TH |
Product Overview : | Recombinant full length Human CLIC2 with an N terminal His tag; 267 amino acids with tag, Predicted MWt 30.5 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 247 amino acids |
Description : | Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 2 is a member of the p64 family; the protein is detected in fetal liver and adult skeletal muscle tissue.This gene maps to the candidate region on chromosome X for incontinentia pigmenti. |
Conjugation : | HIS |
Molecular Weight : | 30.500kDa inclusive of tags |
Tissue specificity : | Detected in adult brain, heart, liver, lung, spleen, stomach and testis. Expressed in fetal liver and adult skeletal muscle. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS |
Sequence Similarities : | Belongs to the chloride channel CLIC family.Contains 1 GST C-terminal domain. |
Gene Name | CLIC2 chloride intracellular channel 2 [ Homo sapiens ] |
Official Symbol | CLIC2 |
Synonyms | CLIC2; chloride intracellular channel 2; chloride intracellular channel protein 2; XAP121; |
Gene ID | 1193 |
mRNA Refseq | NM_001289 |
Protein Refseq | NP_001280 |
MIM | 300138 |
Uniprot ID | O15247 |
Chromosome Location | Xq28 |
Function | chloride channel activity; voltage-gated chloride channel activity; voltage-gated ion channel activity; |
◆ Recombinant Proteins | ||
CLIC2-734R | Recombinant Rhesus Macaque CLIC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLIC2-2179HF | Recombinant Full Length Human CLIC2 Protein, GST-tagged | +Inquiry |
CLIC2-27817TH | Recombinant Human CLIC2 | +Inquiry |
CLIC2-1478H | Recombinant Human CLIC2 Protein, GST-tagged | +Inquiry |
RFL14454RF | Recombinant Full Length Rat Chloride Intracellular Channel Protein 2(Clic2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLIC2-7447HCL | Recombinant Human CLIC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLIC2 Products
Required fields are marked with *
My Review for All CLIC2 Products
Required fields are marked with *
0
Inquiry Basket