Recombinant Human CAPN3
Cat.No. : | CAPN3-27402TH |
Product Overview : | Recombinant fragment of Human Calpain 3 with a proprietary tag at the N terminal; Predicted MW 36.63 kDa, inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | Calpain, a heterodimer consisting of a large and a small subunit, is a major intracellular protease, although its function has not been well established. This gene encodes a muscle-specific member of the calpain large subunit family that specifically binds to titin. Mutations in this gene are associated with limb-girdle muscular dystrophies type 2A. Alternate promoters and alternative splicing result in multiple transcript variants encoding different isoforms and some variants are ubiquitously expressed. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Isoform I is skeletal muscle specific. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | NKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA |
Sequence Similarities : | Belongs to the peptidase C2 family.Contains 1 calpain catalytic domain.Contains 4 EF-hand domains. |
Gene Name | CAPN3 calpain 3, (p94) [ Homo sapiens ] |
Official Symbol | CAPN3 |
Synonyms | CAPN3; calpain 3, (p94); LGMD2, LGMD2A; calpain-3; CANP3; nCL 1; p94; |
Gene ID | 825 |
mRNA Refseq | NM_000070 |
Protein Refseq | NP_000061 |
MIM | 114240 |
Uniprot ID | P20807 |
Chromosome Location | 15q15.1 |
Pathway | Integrin-mediated cell adhesion, organism-specific biosystem; TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem; |
Function | calcium ion binding; calcium-dependent cysteine-type endopeptidase activity; cysteine-type peptidase activity; peptidase activity; signal transducer activity; |
◆ Recombinant Proteins | ||
CAPN3-26374TH | Recombinant Human CAPN3, His-tagged | +Inquiry |
CAPN3-1608H | Recombinant Human CAPN3 Protein (Ile602-Ala821), His tagged | +Inquiry |
CAPN3-301255H | Recombinant Human CAPN3 protein, GST-tagged | +Inquiry |
CAPN3-31H | Recombinant Human CAPN3 protein | +Inquiry |
CAPN3-359C | Recombinant Cynomolgus CAPN3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAPN3-7862HCL | Recombinant Human CAPN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CAPN3 Products
Required fields are marked with *
My Review for All CAPN3 Products
Required fields are marked with *
0
Inquiry Basket