Active Recombinant TEV Protease (AA 5-236), N-GFP and C-His-Tagged

Cat.No. : Protease-75T
Product Overview : Recombinant TEV Protease (AA 5-236) with N-GFP and C-His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Tobaco Etch Virus
Source : E.coli
Tag : GFP&His
Protein Length : AA 5-236
Form : Liquid
Bio-activity : > 0.25 μmol/min/mg (determined by cleavage of labeled peptide (Fluorometric assay), TEV Protease Activity Kit)
AA Sequence : KGPRDYNPISSSICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLVVQSLHGVFKVKDTTTLQQHLVDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMVSDTSCTFPSGDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMNE
Purity : > 85% as determined by SDS-PAGE
Storage : Stored at -20 centigrade and shipped on blue ice
Storage Buffer : 50 mM Tris, 150 mM NaCl, 0.5 mM EDTA, 40% Glycerol; pH 8.0
Official Symbol Protease
Synonyms greenTEV; p1 protease; TEV Protease; TEV; Tobacco Etch Virus nuclear-inclusion-a endopeptidase; rTEV; EC 3.4.22.44
UniProt ID Q0GDU8

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Protease Products

Required fields are marked with *

My Review for All Protease Products

Required fields are marked with *

0

Inquiry Basket

cartIcon