Active Recombinant TEV Protease (AA 5-236), N-GFP and C-His-Tagged

• Cat.No.: Protease-75T
• Product Overview: Recombinant TEV Protease (AA 5-236) with N-GFP and C-His tag was expressed in E. coli.

Specification

• Source: E. coli
• Species: Tobaco Etch Virus
• Tag: His&GFP
• Form: Liquid
• Bio-activity: > 0.25 μmol/min/mg (determined by cleavage of labeled peptide (Fluorometric assay), TEV Protease Activity Kit)
• Protein length: AA 5-236
• AA Sequence: KGPRDYNPISSSICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLVVQSLHGVFKVKDTTTLQQHLVDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMVSDTSCTFPSGDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMNE
• Purity: > 85% as determined by SDS-PAGE
• Storage: Stored at -20 centigrade and shipped on blue ice
• Storage Buffer: 50 mM Tris, 150 mM NaCl, 0.5 mM EDTA, 40% Glycerol; pH 8.0

Gene Information

• Official Symbol: Protease
• Synonyms: greenTEV; p1 protease; TEV Protease; TEV; Tobacco Etch Virus nuclear-inclusion-a endopeptidase; rTEV; EC 3.4.22.44
• UniProt ID: Q0GDU8