Active Recombinant SARS-CoV1 3CL Protease, His-tagged

• Cat.No.: nsp5-107S
• Product Overview: Recombinant 3-chymotrypsin-like (3CL) protease of the SARS-CoV1, a monomeric polypeptide of 318 (307+11) amino acids, with His at C-terminus was expressed in E coli cells and purified by an affinity column in combination of other chromatograph methods.

Specification

• Species: SARS-CoV-1
• Source: E.coli
• Tag: His
• Description: Severe Acute Respiratory Syndrome (SARS), an emerging disease characterized by atypical pneumonia, has been attributed to a novel coronavirus (SARS CoV). The SARS 3C like protease (SARS 3CL(pro)) is a cysteine protease engaging in the proteolytic cleavage of the viral precursor polyprotein to a series of functional proteins required for coronavirus replication and is considered as an attractive target for therapeutics against SARS.
• Bio-activity: Recombinant 3CL protease of SARS-CoV1 is suitable for screening its inhibitors and other related function assays.
• Molecular Mass: 34 kDa
• AA Sequence: MSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQGGGLEHHHHHH*
• Purity: ≥ 90%, as determined by SDS-PAGE.
• Storage: The protein sample can be stored under sterile conditions at 2-8 centigrade for one month or at -20 to -70 centigrade for three months without detectable loss of activity.
• Storage Buffer: Formulation 20 mM Tris-Cl, pH7.9, 20% glycerol, 100 mM NaCl, 1 mM DTT and 0.5 mM EDTA.

Gene Information

• Official Symbol: nsp5
• Synonyms: 3CL; 3C-like proteinase; 3CL PRO; 3CLp; nsp5
• Protein Refseq: NP_828863