Active Recombinant MERS 3CL Protease, His-tagged

• Cat.No.: nsp5-108M
• Product Overview: Recombinant 3-chymotrypsin-like (3CL) protease of the MERS, a monomeric polypeptide of 312 (301+11) amino acids, with His at C-terminus was expressed in E coli cells and purified by an affinity column in combination of other chromatograph methods.

Specification

• Species: MERS
• Source: E.coli
• Tag: His
• Description: Middle East Respiratory Syndrome (MERS) is viral respiratory illness that is new to humans. It was first reported in Saudi Arabia in 2012 and has since spread to several other countries, including the United States. Most people infected with MERS-CoV developed severe respiratory illness, including fever, cough, and shortness of breath.
• Bio-activity: Recombinant 3CL protease of MERS is suitable for screening its inhibitors and other related function assays.
• Molecular Mass: 33 kDa
• AA Sequence: MSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQGGGLEHHHHHH*
• Purity: ≥ 90%, as determined by SDS-PAGE.
• Storage: The protein sample can be stored under sterile conditions at 2-8 centigrade for one month or at -20 to -70 centigrade for three months without detectable loss of activity.
• Storage Buffer: Formulation 20 mM Tris-Cl, pH7.9, 20% glycerol, 100 mM NaCl, 1 mM DTT and 0.5 mM EDTA.

Gene Information

• Official Symbol: nsp5
• Synonyms: 3CL; 3C-like proteinase; 3CL PRO; 3CLp; nsp5
• Protein Refseq: YP_00904217