Active Recombinant Rat Pdgfbb Protein (110 aa)

• Cat.No.: Pdgfb-315P
• Product Overview: Recombinant rat Platelet-Derived Growth Factor-BB (rrPDGF-BB) produced in E. coli is a disulfide-linked homodimer containing two non-glycosylated polypeptide chains of 110 amino acids each. A fully biologically active molecule, rrPDGF-BB has a molecular mass of 24.6 kDa analyzed by non-reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Rat
• Source: E.coli
• Protein Length: 110
• Description: Platelet-Derived Growth Factor-BB (PDGF-BB) is one of five dimers (PDGF-AA, AB, BB, CC, and DD) formed by 4 different PDGF subunits. In vivo, PDGF-BB is mainly produced in heart and placenta, and predominantly expressed by osteoblasts, fibroblasts, smooth muscle cells, and glial cells. An inactive precursor of PDGF-BB is produced in the endoplasmic reticulum and then activated by a proprotein convertase after secretion. PDGF-BB functions in a paracrine manner and promotes organogenesis, human skeletal development, and wound healing. PDGF-BB also promotes angiogenesis, particularly in the presence of Fibroblast Growth Factor basic. Therefore, PDGF-BB and its related pathways are potential pharmacological targets.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 2 ng/mL, measured by a cell proliferation assay using 3T3 Cells, corresponding to a specific activity of > 5 × 10^5 units/mg.
• Molecular Mass: 24.6 kDa, observed by non-reducing SDS-PAGE.
• AA Sequence: MSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPVFKKATVTLEDHLACKCETVVTPRPVT
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE analysis.
• Storage: Lyophilized recombinant rat Platelet-Derived Growth Factor-BB (rrPDGF-BB) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rrPDGF-BB remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against 20 mM acetic acid.
• Reconstitution: Reconstituted in 20 mM acetic acid at 100 μg/mL.

Gene Information

• Gene Name: Pdgfb platelet-derived growth factor beta polypeptide [ Rattus norvegicus ]
• Official Symbol: Pdgfb
• Synonyms: PDGFB; platelet-derived growth factor beta polypeptide; platelet-derived growth factor subunit B; PDGF-2; pdgf protein; PDGF subunit B; platelet-derived growth factor B chain; platelet derived growth factor, B polypeptide; Platelet-derived growth factor, same as Sis (Simian sarcoma viral oncogene homologue, c-sis); platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog); SIS; c-sis
• Gene ID: 24628
• mRNA Refseq: NM_031524
• Protein Refseq: NP_113712
• UniProt ID: Q05028