Active Recombinant Rat Il10 Protein

• Cat.No.: Il10-260I
• Product Overview: Recombinant Rat Il10 Protein without tag was expressed in CHO.

Specification

• Species: Rat
• Source: CHO
• Description: Interleukin-10 (IL-10), initially known as Cytokine Synthesis Inhibitory Factor (CSIF), belongs to the IL-10 family and shares more than 80% sequence homology with the Epstein-Barr Virus protein BCRFI. It is produced by many immune cells, such as T-cells, macrophages, mast cells and dendritic cells. It is usually secreted as a homodimer and, upon binding to its receptor, inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and Th2 cells. It also displays the ability to suppress Antigen-Presenting Cell (APC) function. The net effect of Interleukin-10 appears to be inhibitory; however, stimulatory effects, such as stimulation of B cell maturation and antibody production, are also reported.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 8μg/mL, measured in a bioassay using C6 cells.
• Molecular Mass: 8-22 kDa, observed by reducing SDS-PAGE.
• AA Sequence: SKGHSIRGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNILLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant rat Interleukin-10(IL-10) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Rat Interleukin-10 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Il10 interleukin 10 [ Rattus norvegicus ]
• Official Symbol: Il10
• Synonyms: IL10; interleukin 10; interleukin-10; CSIF; IL-10; cytokine synthesis inhibitory factor; IL10X
• Gene ID: 25325
• mRNA Refseq: NM_012854
• Protein Refseq: NP_036986
• UniProt ID: P29456