Recombinant Rhesus macaque IL10 protein, His-B2M-tagged
Cat.No. : | IL10-3090R |
Product Overview : | Recombinant Rhesus macaque IL10 protein(P51496)(19-178aa), fused to N-terminal His tag and B2M tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | E.coli |
Tag : | B2M&His |
Protein Length : | 19-178aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.7 kDa |
AA Sequence : | SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
IL10-174H | Active Recombinant Human IL10 Protein (Ser19-Asn178), C-His tagged, Animal-free, Carrier-free | +Inquiry |
IL10-837D | Recombinant Dog IL10 protein, His & GST-tagged | +Inquiry |
IL10-215F | Active Recombinant Feline IL10 | +Inquiry |
IL10-46H | Recombinant Human IL10 Protein | +Inquiry |
IL10-499H | Recombinant Human IL10 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL10-2079HCL | Recombinant Human IL10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL10 Products
Required fields are marked with *
My Review for All IL10 Products
Required fields are marked with *
0
Inquiry Basket