Active Recombinant Rat Ifng Protein

• Cat.No.: Ifng-192R
• Product Overview: Recombinant Rat Ifng Protein without tag was expressed in E. coli.

Specification

• Description: Interferon-gamma (IFN-γ), also known as Type II interferon or immune interferon, is a cytokine produced primarily by T-lymphocytes and natural killer cells. The protein shares no significant homology with IFN-β or the various IFN-α family proteins. Mature IFN-γ exists as noncovalently-linked homodimers. It shares high sequence indentity with mouse IFN-γ (86 %). IFN-γ was originally characterized based on its antiviral activities. The protein also exerts antiproliferative, immunoregulatory and proinflammatory activities and is thus important in host defense mechanisms. IFN-γ induces the production of cytokines, upregulates the expression of class I and II MHC antigens, Fc receptor and leukocyte adhesion molecules. It modulates macrophage effector functions, influences isotype switching and potentiates the secretion of immunoglobulins by B cells. Additionally, IFN-γ augments TH1 cell expansion and may be required for TH1 cell differentiation.
• Source: E. coli
• Species: Rat
• Tag: Non
• Form: Sterile Filtered White lyophil
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by an anti-viral assay using murine L929 cells infected with encephalomyocarditis (EMC) virus is less than 0.1 ng/mL, corresponding to a specific activity of > 1.0×10^7 IU/mg.
• Molecular Mass: Approximately 15.5 kDa
• AA Sequence: QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
• Endotoxin: Less than 0.1 EU/μg of rRtIFN-a as determined by LAL method.
• Purity: > 97% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze thaw cycles.
• Storage Buffer: Lyophilized from a 0.2 μm filtered concentrated solution in 1×PBS, pH 7.4, 1 mM DTT, 5 % Trehalose and 0.05 % Tween-80.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10 mM HAc to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at -20 centigrade.

Gene Information

• Gene Name: Ifng interferon gamma [ Rattus norvegicus (Norway rat) ]
• Official Symbol: Ifng
• Synonyms: IFNG; interferon gamma; IFN-gamma; IFNG2
• Gene ID: 25712
• mRNA Refseq: NM_138880
• Protein Refseq: NP_620235
• UniProt ID: P01581