Active Recombinant Rat Fgf1 Protein

• Cat.No.: Fgf1-4096R
• Product Overview: Rat Fgf1 (P61149) partial recombinant protein expressed in Escherichia coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: Non
• Description: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Three alternatively spliced variants encoding different isoforms have been described.
• Form: Lyophilized
• Bio-activity: Determined by a cell proliferation assay using balb/c 3T3 cells. The expected ED50 is ≤ 0.1 ng/mL, in the presence of 10 μg/mL heparin, corresponding to a specific activity of ≥ 1 x 107 units/mg.
• Molecular Mass: 15.9 kDa
• AA Sequence: MFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
• Endotoxin: Endotoxin level is < 0.1 ng/μg (< 1 EU/μg).
• Purity: 95%
• Applications: Functional Study
  SDS-PAGE
• Usage: Activity assay
  SDS-PAGE
  The optimal working dilution should be determined by the end user.
• Storage: Store at -20 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: Lyophilized from solutions contain no sodiun azide nor carrier protein

Gene Information

• Gene Name: Fgf1 fibroblast growth factor 1 [ Rattus norvegicus ]
• Official Symbol: Fgf1
• Synonyms: FGF1; fibroblast growth factor 1; aFGF; acidic fibroblast growth factor; heparin-binding growth factor 1; Fibroblast growth factor 1 (heparin binding); FGF-1; HBGF1; HBGF-1
• Gene ID: 25317
• mRNA Refseq: NM_012846
• Protein Refseq: NP_036978