Active Recombinant Rat EGF Protein
Cat.No. : | EGF-76R |
Product Overview : | Recombinant Rat EGF Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Description : | Epidermal growth factor (EGF) is a growth factor that stimulates the proliferation, differentiation, and survival of epithelial and epidermal cells. EGF contains three intramolecular disulfide bonds and binds in high affinity to the epidermal growth factor receptor (EGFR). |
Bio-activity : | 3T3 proliferation, ≤1 ng/mL |
Molecular Mass : | Monomer, 6.3 kDa (54 aa) |
AA Sequence : | MNSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Egf epidermal growth factor [ Rattus norvegicus (Norway rat) ] |
Official Symbol | EGF |
Synonyms | EGF; epidermal growth factor; pro-epidermal growth factor; |
Gene ID | 25313 |
mRNA Refseq | NM_012842 |
Protein Refseq | NP_036974 |
UniProt ID | P07522 |
◆ Recombinant Proteins | ||
EGF-429E | Active Recombinant Human EGF Protein (53 aa) | +Inquiry |
EGF-020E | Recombinant Human EGF protein | +Inquiry |
EGF-479H | Recombinant Human EGF, Met | +Inquiry |
Egf-460R | Recombinant Rat Epidermal Growth Factor | +Inquiry |
EGF-261M | Recombinant Mouse Egf, None tagged | +Inquiry |
◆ Native Proteins | ||
Egf-635R | Native Rat Egf | +Inquiry |
Egf-634M | Active Native Mouse Egf | +Inquiry |
EGF-26462TH | Native Human EGF | +Inquiry |
EGF-23H | Active Native Human EGF protein | +Inquiry |
Egf -635R | Native Rat Egf protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGF-2716HCL | Recombinant Human EGF cell lysate | +Inquiry |
EGF-973MCL | Recombinant Mouse EGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EGF Products
Required fields are marked with *
My Review for All EGF Products
Required fields are marked with *
0
Inquiry Basket