Recombinant Human EGF Protein, GST-tagged
Cat.No. : | EGF-3113H |
Product Overview : | Human EGF partial ORF ( NP_001954, 926 a.a. - 1025 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the epidermal growth factor superfamily. The encoded preproprotein is proteolytically processed to generate the 53-amino acid epidermal growth factor peptide. This protein acts a potent mitogenic factor that plays an important role in the growth, proliferation and differentiation of numerous cell types. This protein acts by binding with high affinity to the cell surface receptor, epidermal growth factor receptor. Defects in this gene are the cause of hypomagnesemia type 4. Dysregulation of this gene has been associated with the growth and progression of certain cancers. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. [provided by RefSeq, Jan 2016] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | NASCTNTEGGYTCMCAGRLSEPGLICPDSTPPPHLREDDHHYSVRNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWKLRHA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EGF epidermal growth factor [ Homo sapiens ] |
Official Symbol | EGF |
Synonyms | EGF; epidermal growth factor; epidermal growth factor (beta urogastrone); pro-epidermal growth factor; beta-urogastrone; URG; HOMG4; |
Gene ID | 1950 |
mRNA Refseq | NM_001178130 |
Protein Refseq | NP_001171601 |
MIM | 131530 |
UniProt ID | P01133 |
◆ Recombinant Proteins | ||
EGF-262M | Active Recombinant Mouse EGF Protein | +Inquiry |
EGF-62H | Recombinant Active Human EGF Protein, His-tagged(C-ter) | +Inquiry |
EGF-3113H | Recombinant Human EGF Protein, GST-tagged | +Inquiry |
Egf-868M | Active Recombinant Mouse Egf protein(Asn977-Arg1029), hFc-tagged | +Inquiry |
EGF-5229H | Recombinant Human EGF protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
EGF-23H | Active Native Human EGF protein | +Inquiry |
Egf -635R | Native Rat Egf protein | +Inquiry |
Egf-635R | Native Rat Egf | +Inquiry |
EGF-26462TH | Native Human EGF | +Inquiry |
Egf -634M | Active Native Mouse Egf protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGF-973MCL | Recombinant Mouse EGF cell lysate | +Inquiry |
EGF-2716HCL | Recombinant Human EGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EGF Products
Required fields are marked with *
My Review for All EGF Products
Required fields are marked with *
0
Inquiry Basket