Active Recombinant Rat Csf3 Protein
Cat.No. : | Csf3-188C |
Product Overview : | Recombinant Rat Csf3 Protein without tag was expressed in HEK 293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | HEK293 |
Description : | Among the family of colony-stimulating factors, Granulocyte Colony-Stimulating Factor (G-CSF) is the most potent inducer of terminal differentiation of leukemic myeloid cell lines into granulocytes and macrophages. G-CSF synthesis can be induced by bacterial endotoxins, TNF, Interleukin-1 and GM-CSF. Prostaglandin E2 inhibits G-CSF synthesis. In epithelial, endothelial, and fibroblastic cells, secretion of G-CSF is induced by Interleukin-17. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 5 pg/mL, measured in a cell proliferation assay using NFS-60 cells. |
Molecular Mass : | 25~28 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | IPLLTVSSLPPSLPLPRSFLLKSLEQVRKIQARNTELLEQLCATYKLCHPEELVLFGHSLGIPKASLSSCSSQALQQTKCLSQLHSGLFLYQGLLQALAGISSELAPTLDMLHLDVDNFATTIWQQMESLGVAPTVQPTQSTMPIFTSAFQRRAGGVLVTSYLQSFLETAHHALHHLPRPAQKHFPESLFISI |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant Rat Granulocyte Colony-Stimulating Factor (G-CSF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Rat Granulocyte Colony-Stimulating Factor (G-CSF) should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Csf3 colony stimulating factor 3 (granulocyte) [ Rattus norvegicus ] |
Official Symbol | Csf3 |
Synonyms | CSF3; colony stimulating factor 3 (granulocyte); granulocyte colony-stimulating factor; |
Gene ID | 25610 |
mRNA Refseq | NM_017104 |
Protein Refseq | NP_058800 |
◆ Recombinant Proteins | ||
CSF3-470H | Active Recombinant Human Colony Stimulating Factor 3 (Granulocyte) | +Inquiry |
CSF3-2742D | Recombinant Dog CSF3 protein, His-SUMO-tagged | +Inquiry |
CSF3-4407C | Recombinant Chicken CSF3 Protein | +Inquiry |
CSF3-178H | Active Recombinant Human CSF3 Protein | +Inquiry |
Csf3-5616M | Active Recombinant Mouse Colony Stimulating Factor 3 (granulocyte), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF3-2948HCL | Recombinant Human CSF3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Csf3 Products
Required fields are marked with *
My Review for All Csf3 Products
Required fields are marked with *
0
Inquiry Basket