Active Recombinant Rat Csf3 Protein

• Cat.No.: Csf3-188C
• Product Overview: Recombinant Rat Csf3 Protein without tag was expressed in HEK 293.

Specification

• Species: Rat
• Source: HEK293
• Description: Among the family of colony-stimulating factors, Granulocyte Colony-Stimulating Factor (G-CSF) is the most potent inducer of terminal differentiation of leukemic myeloid cell lines into granulocytes and macrophages. G-CSF synthesis can be induced by bacterial endotoxins, TNF, Interleukin-1 and GM-CSF. Prostaglandin E2 inhibits G-CSF synthesis. In epithelial, endothelial, and fibroblastic cells, secretion of G-CSF is induced by Interleukin-17.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 5 pg/mL, measured in a cell proliferation assay using NFS-60 cells.
• Molecular Mass: 25~28 kDa, observed by reducing SDS-PAGE.
• AA Sequence: IPLLTVSSLPPSLPLPRSFLLKSLEQVRKIQARNTELLEQLCATYKLCHPEELVLFGHSLGIPKASLSSCSSQALQQTKCLSQLHSGLFLYQGLLQALAGISSELAPTLDMLHLDVDNFATTIWQQMESLGVAPTVQPTQSTMPIFTSAFQRRAGGVLVTSYLQSFLETAHHALHHLPRPAQKHFPESLFISI
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant Rat Granulocyte Colony-Stimulating Factor (G-CSF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Rat Granulocyte Colony-Stimulating Factor (G-CSF) should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Csf3 colony stimulating factor 3 (granulocyte) [ Rattus norvegicus ]
• Official Symbol: Csf3
• Synonyms: CSF3; colony stimulating factor 3 (granulocyte); granulocyte colony-stimulating factor
• Gene ID: 25610
• mRNA Refseq: NM_017104
• Protein Refseq: NP_058800