Active Recombinant Mouse Tnf Protein

• Cat.No.: Tnf-733M
• Product Overview: Recombinant Mouse Tnf Protein without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Description: Tumor necrosis factor alpha (TNF-α), also called cachectin, is the best-know member of the TNF-family, which can cause cell death. This protein is produced by neutrophils, activated lymphocytes, macrophages, NK cells, LAK cells, astrocytes endothelial cells, smooth muscle cells and some transformed cells. TNF-α occurs as a secreted, soluble form and as a membrane-anchored form, both of which are biologically active. The naturally-occurring form of TNF-α is glycosylated, but non-glycosylated recombinant TNF-α has comparable biological activity. The biologically active native form of TNF-α is reportedly a trimer. Human and murine TNF-α show approximately 79 % homology at the amino acid level and cross-reactivity between the two species. Two types of receptors for TNF-α have been described and virtually all cell types studied show the presence of one or both of these receptor types.
• Form: Sterile Filtered White lyophil
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cytotoxicity assay using murine L929 cells is less than 0.1 ng/mL, corresponding to a specific activity of > 1.0×10^7 IU mg in the presence of actinomycin D.
• Molecular Mass: Approximately 17.4 kDa. The re
• AA Sequence: MLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
• Endotoxin: Less than 1 EU/ag of rMuTNF-a as determined by LAL method.
• Purity: > 98% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze thaw cycles.
• Storage Buffer: Lyophilized from a 0.2 μm filtered solution in PBS, pH 7.2.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL.

Gene Information

• Gene Name: Tnf tumor necrosis factor [ Mus musculus (house mouse) ]
• Official Symbol: Tnf
• Synonyms: TNF; tumor necrosis factor; TNF-a; TNF alpha; cachectin; tumor necrosis factor alpha; tumor necrosis factor-alpha; tumor necrosis factor ligand superfamily member 2; DIF; Tnfa; TNFSF2; Tnfsf1a; TNFalpha; TNF-alpha; MGC151434
• Gene ID: 21926
• mRNA Refseq: NM_013693
• Protein Refseq: NP_038721
• UniProt ID: P06804