Active Recombinant Rhesus Macaque TNF Protein (157 aa)
Cat.No. : | TNF-303T |
Product Overview : | Recombinant Rhesus Macaque TNF-α produced in E. coli is a single, non-glycosylated polypeptide chain containing 157 amino acids. A fully biologically active molecule, Recombinant Rhesus Macaque TNF-α has a molecular mass of 17.4 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | E.coli |
Protein Length : | 157 |
Description : | Tumor Necrosis Factor-Alpha (TNF-α) plays a major role in regulating growth, differentiation, inflammation, viral replication, tumorigenesis, and autoimmune disease. TNF alpha-1a is a potent lymphoid factor that exerts cytotoxic effects on a wide range of tumor cells. In addition to inducing hemorrhagic necrosis of tumors, studies indicate TNF is involved in certain types of tumorigenesis, tumor metastasis, viral replication, septic shock, fever, inflammation, Crohn's disease, rheumatoid arthritis and graft-versus-host disease. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 60 pg/mL, measured in a cytotoxicity assay using mouse L-929 cells in the presence of actinomycin D, corresponding to a specific activity of > 1.6 × 10^7 units/mg. |
Molecular Mass : | 17.4 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | VRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELTDNQLVVPSEGLYLIYSQVLFKGQGCPSNHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE& HPLC |
Storage : | Lyophilized recombinant Rhesus Macaque TNF-α, remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Rhesus Macaque TNF-α should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | TNF tumor necrosis factor [ Macaca mulatta (Rhesus monkey) ] |
Official Symbol | TNF |
Synonyms | TNF; tumor necrosis factor; TNLG1F; TNF-ALPHA; tumor necrosis factor; ATP-binding cassette, sub-family F (GCN20), member 1; TNF-a; cachectin; tumor necrosis factor (TNF superfamily, member 2); tumor necrosis factor alpha; tumor necrosis factor ligand 1F; tumor necrosis factor ligand superfamily member 2 |
Gene ID | 715467 |
mRNA Refseq | NM_001047149 |
Protein Refseq | NP_001040614 |
UniProt ID | P48094 |
◆ Recombinant Proteins | ||
TNF-3597B | Recombinant Bovine TNF protein, GST-tagged | +Inquiry |
Tnf-509M | Active Recombinant Mouse Tnf | +Inquiry |
TNF-379D | Recombinant Dog Tumor Necrosis Factor | +Inquiry |
TNF-72H | Recombinant Human TNF, His-tagged | +Inquiry |
TNF-79P | Recombinant Porcine Tumor Necrosis Factor-Alpha, biologically active | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNF-897HCL | Recombinant Human TNF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNF Products
Required fields are marked with *
My Review for All TNF Products
Required fields are marked with *
0
Inquiry Basket