Active Recombinant Mouse Rspo1, Fc-tagged, Biotinylated

Cat.No. : Rspo1-723M
Product Overview : The recombinant mouse RPSO1-Fc fusion is expressed as a 483 amino acid protein consisting of Ser21 - Gln265 region of (UniProt accession #Q9Z132) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : Human cells
Species : Mouse
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Synergizes with Wnt3a to stabilize β-catenin protein levels and induces the activation of β-catenin responsive Luciferase reporter gene in HEK293 cells with a typical ED50 of 60 - 300 ng/ml.
Molecular Mass : Calculated molecular mass (kDa): 53.8; Estimated by SDS-PAGE under reducing condition (kDa): 55-60.
AA Sequence : SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCI KCKIEHCEACFSHNFCTKCQEGLYLHKGRCYPACPEGSTAANSTMECGSPAQCEMSEWSPWGPCSKKRKLCGFR KGSEERTRRVLHAPGGDHTTCSDTKETRKCTVRRTPCPEGQKRRKGGQGRRENANRHPARKNSKEPGSNSRRHK GQQQPQPGTTGPLTSVGPTWAQSTTENLYFQGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Protein length : 21-265 a.a.
Gene Name Rspo1 R-spondin homolog (Xenopus laevis) [ Mus musculus ]
Official Symbol Rspo1
Synonyms RSPO1; R-spondin homolog (Xenopus laevis); R-spondin-1; cristin-3; mCristin-3; roof plate-specific spondin-1; thrombospondin type 1 domain containing gene Rspondin; cysteine-rich and single thrombospondin domain-containing protein 3; Rspondin; R-spondin;
Gene ID 192199
mRNA Refseq NM_138683
Protein Refseq NP_619624
MIM
UniProt ID
Function heparin binding; receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Rspo1 Products

Required fields are marked with *

My Review for All Rspo1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon