Active Recombinant Mouse Ngf Protein

• Cat.No.: Ngf-4406M
• Product Overview: Purified recombinant protein of Mouse nerve growth factor (Ngf), transcript variant A without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades to regulate neuronal proliferation, differentiation and survival. The immature NGF precursor (proNGF) functions as ligand for the heterodimeric receptor formed by SORCS2 and NGFR, and activates cellular signaling cascades that lead to inactivation of RAC1 and/or RAC2, reorganization of the actin cytoskeleton and neuronal growth cone collapse. In contrast to mature NGF, the precursor form (proNGF) promotes neuronal apoptosis (in vitro). Inhibits metalloproteinase-dependent proteolysis of platelet glycoprotein VI. Binds lysophosphatidylinositol and lysophosphatidylserine between the two chains of the homodimer. The lipid-bound form promotes histamine relase from mast cells, contrary to the lipid-free form.
• Bio-activity: ED50 as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is less than or equal to 1.0 ng/mL, corresponding to a specific activity of > 1 × 10^6 units/mg.
• Molecular Mass: 13.4 kDa
• AA Sequence: SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG
• Endotoxin: < 0.1 ng/μg of protein (< 1 EU/μg)
• Purity: > 95% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2

Gene Information

• Gene Name: Ngf nerve growth factor [ Mus musculus (house mouse) ]
• Official Symbol: Ngf
• Synonyms: NGF; nerve growth factor; beta-nerve growth factor; beta-NGF; nerve growth factor, beta; Ngfb
• Gene ID: 18049
• mRNA Refseq: NM_013609
• Protein Refseq: NP_038637
• UniProt ID: P01139