Recombinant Human Nerve Growth Factor (beta polypeptide)

• Cat.No.: NGF-1869H
• Product Overview: Recombinant human NGFis a non-glycosylated, polypeptide chain containing 222 amino acids and has aMW = 49.8 kDa.

Specification

• Cat. No.: NGF-1869H
• Description: NGF is critical forthe survival and maintenance of sympathetic and sensory nuerons and may playan important role in the regulation of the immune system . Nerve growthfactor (NGF) is a small secreted protein that is important for the growth,maintenance, and survival of certain target neurons (nerve cells). It alsofunctions as a signaling molecule.
• Source: E. coli
• Species: Human
• Form: Liquid in a sterilefiltered buffer of 50 mM sodium phosphate, pH 7.2 + 150 mM sodium chloride.
• MolecularWeight: 49.8 kDa
• Purity: > 98% as determinedby RP-HPLC and SDS-PAGE.
• Endotoxin Level: < 0.1 ng/µg ofthe protein.
• Biological Activity: Determined by itsstimulation of the proliferation of TF1 cells (TF1 cell assay). The EC50 of130 ± 30 pM.
• Sequence: MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAR
• Storage: Centrifuge vialprior to opening Although stable for three weeks at ambient temperature,product should be stored at 2-4°C. For long term storage, it is recommendedto add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze-thaw cycles.
• OfficialSymbol: NGF
• Tag: Non

Gene Information

• Gene Name: NGF nerve growth factor (betapolypeptide) [ Homo sapiens ]
• Synonyms: NGF; nerve growthfactor (beta polypeptide); NGFB; HSAN5; Beta-NGF; MGC161426; MGC161428;beta-nerve growth factor; OTTHUMP00000013653; nerve growth factor, betasubunit
• Gene ID: 4803
• mRNA Refseq: NM_002506
• Protein Refseq: NP_002497
• MIM: 162030
• UniProt ID: P01138
• Chromosome Location: 1p13.1
• Pathway: ARMS-mediatedactivation; Cell death signalling via NRAGE; Frs2-mediated activation; MAPKsignaling pathway; NADE modulates death signalling; NRAGE signals deaththrough JNK; PLC-gamma1 signalling; Retrograde neurotrophin signalling;Retrograde neurotrophin signalling; Signalling to p38 via RIT and RIN; TRKAactivation by NGF; p75NTR negatively regulates cell cycle via SC1; p75NTR regulatesaxonogenesis; p75NTR signals via NF-kB
• Function: growth factoractivity; nerve growth factor receptor binding; receptor signaling proteinactivity; signal transducer activity