Recombinant Human Nerve Growth Factor (beta polypeptide)
Cat.No. : | NGF-1869H |
Product Overview : | Recombinant human NGFis a non-glycosylated, polypeptide chain containing 222 amino acids and has aMW = 49.8 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | NGF is critical forthe survival and maintenance of sympathetic and sensory nuerons and may playan important role in the regulation of the immune system . Nerve growthfactor (NGF) is a small secreted protein that is important for the growth,maintenance, and survival of certain target neurons (nerve cells). It alsofunctions as a signaling molecule. |
Form : | Liquid in a sterilefiltered buffer of 50 mM sodium phosphate, pH 7.2 + 150 mM sodium chloride. |
MolecularWeight : | 49.8 kDa |
Purity : | > 98% as determinedby RP-HPLC and SDS-PAGE. |
Endotoxin Level : | < 0.1 ng/µg ofthe protein. |
Biological Activity : | Determined by itsstimulation of the proliferation of TF1 cells (TF1 cell assay). The EC50 of130 ± 30 pM. |
Sequence : | MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAR |
Storage : | Centrifuge vialprior to opening Although stable for three weeks at ambient temperature,product should be stored at 2-4°C. For long term storage, it is recommendedto add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze-thaw cycles. |
OfficialSymbol : | NGF |
Gene Name | NGF nerve growth factor (betapolypeptide) [ Homo sapiens ] |
Synonyms | NGF; nerve growthfactor (beta polypeptide); NGFB; HSAN5; Beta-NGF; MGC161426; MGC161428;beta-nerve growth factor; OTTHUMP00000013653; nerve growth factor, betasubunit |
Gene ID | 4803 |
mRNA Refseq | NM_002506 |
Protein Refseq | NP_002497 |
MIM | 162030 |
UniProt ID | P01138 |
Chromosome Location | 1p13.1 |
Pathway | ARMS-mediatedactivation; Cell death signalling via NRAGE; Frs2-mediated activation; MAPKsignaling pathway; NADE modulates death signalling; NRAGE signals deaththrough JNK; PLC-gamma1 signalling; Retrograde neurotrophin signalling;Retrograde neurotrophin signalling; Signalling to p38 via RIT and RIN; TRKAactivation by NGF; p75NTR negatively regulates cell cycle via SC1; p75NTR regulatesaxonogenesis; p75NTR signals via NF-kB |
Function | growth factoractivity; nerve growth factor receptor binding; receptor signaling proteinactivity; signal transducer activity |
◆ Recombinant Proteins | ||
NGF-002H | Active Recombinant Human NGF, MIgG2a Fc-tagged | +Inquiry |
NGF-588H | Recombinant Human NGF protein | +Inquiry |
Ngf-5481R | Recombinant Rat Ngf protein, His-tagged | +Inquiry |
NGF-1178H | Recombinant Human Nerve Growth Factor (beta polypeptide) | +Inquiry |
NGF-476H | Active Recombinant Human Nerve Growth Factor (Beta Polypeptide) | +Inquiry |
◆ Native Proteins | ||
Ngf-298M | Active Native Mouse Nerve Growth Factor | +Inquiry |
Ngf-51M | Native Mouse Nerve Growth Factor 2.5S | +Inquiry |
Ngf-182M | Active Native Mouse Ngf Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NGF-001MCL | Recombinant Mouse NGF cell lysate | +Inquiry |
NGF-001HCL | Recombinant Human NGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NGF Products
Required fields are marked with *
My Review for All NGF Products
Required fields are marked with *
0
Inquiry Basket