Recombinant Human Nerve Growth Factor (beta polypeptide)

Cat.No. : NGF-1869H
Product Overview : Recombinant human NGFis a non-glycosylated, polypeptide chain containing 222 amino acids and has aMW = 49.8 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : NGF is critical forthe survival and maintenance of sympathetic and sensory nuerons and may playan important role in the regulation of the immune system . Nerve growthfactor (NGF) is a small secreted protein that is important for the growth,maintenance, and survival of certain target neurons (nerve cells). It alsofunctions as a signaling molecule.
Form : Liquid in a sterilefiltered buffer of 50 mM sodium phosphate, pH 7.2 + 150 mM sodium chloride.
MolecularWeight : 49.8 kDa
Purity : > 98% as determinedby RP-HPLC and SDS-PAGE.
Endotoxin Level : < 0.1 ng/µg ofthe protein.
Biological Activity : Determined by itsstimulation of the proliferation of TF1 cells (TF1 cell assay). The EC50 of130 ± 30 pM.
Sequence : MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAR
Storage : Centrifuge vialprior to opening Although stable for three weeks at ambient temperature,product should be stored at 2-4°C. For long term storage, it is recommendedto add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze-thaw cycles.
OfficialSymbol : NGF
Gene Name NGF nerve growth factor (betapolypeptide) [ Homo sapiens ]
Synonyms NGF; nerve growthfactor (beta polypeptide); NGFB; HSAN5; Beta-NGF; MGC161426; MGC161428;beta-nerve growth factor; OTTHUMP00000013653; nerve growth factor, betasubunit
Gene ID 4803
mRNA Refseq NM_002506
Protein Refseq NP_002497
MIM 162030
UniProt ID P01138
Chromosome Location 1p13.1
Pathway ARMS-mediatedactivation; Cell death signalling via NRAGE; Frs2-mediated activation; MAPKsignaling pathway; NADE modulates death signalling; NRAGE signals deaththrough JNK; PLC-gamma1 signalling; Retrograde neurotrophin signalling;Retrograde neurotrophin signalling; Signalling to p38 via RIT and RIN; TRKAactivation by NGF; p75NTR negatively regulates cell cycle via SC1; p75NTR regulatesaxonogenesis; p75NTR signals via NF-kB
Function growth factoractivity; nerve growth factor receptor binding; receptor signaling proteinactivity; signal transducer activity

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NGF Products

Required fields are marked with *

My Review for All NGF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon