Recombinant Human NGF protein

• Cat.No.: NGF-588H
• Product Overview: Recombinant Human NGF(Ser122-Arg239) was expressed in HEK293.

Specification

• Source: HEK293
• Species: Human
• Form: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 250mM NaCl, pH 7.0
• Protein length: Ser122-Arg239
• AA Sequence: SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKH WNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR
• Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Tag: Non

Gene Information

• Gene Name: NGF nerve growth factor (beta polypeptide) [ Homo sapiens ]
• Official Symbol: NGF
• Synonyms: NGF; nerve growth factor (beta polypeptide); NGFB; beta-nerve growth factor; nerve growth factor, beta subunit; HSAN5; Beta-NGF; MGC161426; MGC161428
• Gene ID: 4803
• mRNA Refseq: NM_002506
• Protein Refseq: NP_002497
• MIM: 162030
• UniProt ID: P01138
• Chromosome Location: 1p13.1
• Pathway: ARMS-mediated activation, organism-specific biosystem; Activation of TRKA receptors, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Axonal growth stimulation, organism-specific biosystem; Cell death signalling via NRAGE, NRIF and NADE, organism-specific biosystem; Ceramide signalling, organism-specific biosystem
• Function: growth factor activity; nerve growth factor receptor binding; receptor signaling protein activity