Active Recombinant Mouse Mdk Protein
Cat.No. : | Mdk-124M |
Product Overview : | Purified recombinant protein of Mouse midkine (Mdk), transcript variant 1 without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | This gene encodes a secreted growth factor that belongs to the pleiotrophin/midkine heparin-binding protein family and functions in a variety of biological processes. The encoded cytokine promotes the growth, differentiation, survival and migration of several target cells including leucocytes involved in inflammation. This protein plays a role in the formation of scar tissue and intraperitoneal adhesions, and promotes neurite outgrowth and neuron survival. The protein encoded by this gene is associated with obesity and inhibition of insulin signaling in fat cells. A pseudogene of this gene is present on chromosome 11. Alternative splicing results in multiple transcript variants. |
Bio-activity : | Determined by its ability to chemoattract human neutrophils using a concentration range of 10-100 ng/ml.Cell treatment (PMID: 28489825) |
Molecular Mass : | 13.3 kDa |
AA Sequence : | VAKKKEKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRVHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKTKAKKGKGKD |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Mdk midkine [ Mus musculus (house mouse) ] |
Official Symbol | Mdk |
Synonyms | Mdk; midkine; MK; Mek; midkine; retanoic acid-responsive protein; retinoic acid-induced differentiation factor; retinoic acid-responsive protein |
Gene ID | 17242 |
mRNA Refseq | NM_010784 |
Protein Refseq | NP_034914 |
UniProt ID | P12025 |
◆ Recombinant Proteins | ||
MDK-197H | Active Recombinant Human MDK protein | +Inquiry |
Mdk-0484M | Recombinant Mouse Mdk protein, His-tagged | +Inquiry |
Mdk-0485M | Recombinant Mouse Mdk protein, His-Avi-tagged, Biotinylated | +Inquiry |
MDK-236H | Recombinant Active Human MDK Protein, Tag Free | +Inquiry |
MDK-30202TH | Recombinant Human MDK | +Inquiry |
◆ Cell & Tissue Lysates | ||
MDK-568HCL | Recombinant Human MDK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Mdk Products
Required fields are marked with *
My Review for All Mdk Products
Required fields are marked with *
0
Inquiry Basket