Active Recombinant Mouse IL7 Protein

• Cat.No.: Il7-475M
• Product Overview: Interleukin-7 Mouse Recombinant produced in E. coli is a single, non-glycosylated polypeptide chain containing 129 amino acids and having a molecular mass of 14.9 kDa.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Description: The protein encoded by this gene is a hematopoietic growth factor important for B and T cell development. Alternative splicing results in several transcript variants encoding different isoforms.
• Source: E. coli
• Species: Mouse
• Tag: Non
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Molecular Weight: 14.9 kDa
• AA Sequence: ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI
• Bio-Activity: The ED50 was determined by the dose-dependent stimulation of the proliferation of murine 2E8 cells is less than 0.2 ng/mL, corresponding to a specific activity of >5.0×10^6 IU/mg.
• Purity: Greater than 96.0% as determined by: (a) Analysis by RP-HPLC; (b) Analysis by SDS-PAGE.
• Notes: Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
• Solubility: It is recommended to reconstitute the lyophilized Interleukin 7 in sterile 18 MΩ-cm H2O not less than 100 μg/mL, which can then be further diluted to other aqueous solutions.
• Stability: Lyophilized Interleukin-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18 centigrade. Upon reconstitution IL7 should be stored at 4 centigrade between 2-7 days and for future use below -18 centigrade.
  For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
  Please prevent freeze-thaw cycles.
• Storage Buffer: Filtered (0.2μm) and lyophilized from a concentrated (1 mg/mL) solution in 1×PBS, pH7.4 and 2% trehalose.
• Reference: 1. Disruption of Bis Leads to the Deterioration of the Vascular Niche for Hematopoietic Stem Cells. Publication: Stem Cells 28.2 (2010): 268-278.

Gene Information

• Gene Name: Il7 interleukin 7 [ Mus musculus ]
• Official Symbol: Il7
• Synonyms: IL7; interleukin 7; interleukin-7; Il-7; hlb368; A630026I06Rik; MGC129342
• Gene ID: 16196
• mRNA Refseq: NM_008371
• Protein Refseq: NP_032397
• UniProt ID: P10168