Active Recombinant Mouse IL7 Protein
Cat.No. : | Il7-475M |
Product Overview : | Interleukin-7 Mouse Recombinant produced in E. coli is a single, non-glycosylated polypeptide chain containing 129 amino acids and having a molecular mass of 14.9 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Description : | The protein encoded by this gene is a hematopoietic growth factor important for B and T cell development. Alternative splicing results in several transcript variants encoding different isoforms. |
Source : | E. coli |
Species : | Mouse |
Tag : | Non |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Molecular Weight : | 14.9 kDa |
AA Sequence : | ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI |
Bio-Activity : | The ED50 was determined by the dose-dependent stimulation of the proliferation of murine 2E8 cells is less than 0.2 ng/mL, corresponding to a specific activity of >5.0×10^6 IU/mg. |
Purity : | Greater than 96.0% as determined by: (a) Analysis by RP-HPLC; (b) Analysis by SDS-PAGE. |
Notes : | Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. |
Solubility : | It is recommended to reconstitute the lyophilized Interleukin 7 in sterile 18 MΩ-cm H2O not less than 100 μg/mL, which can then be further diluted to other aqueous solutions. |
Stability : | Lyophilized Interleukin-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18 centigrade. Upon reconstitution IL7 should be stored at 4 centigrade between 2-7 days and for future use below -18 centigrade. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
Storage Buffer : | Filtered (0.2μm) and lyophilized from a concentrated (1 mg/mL) solution in 1×PBS, pH7.4 and 2% trehalose. |
Reference : | 1. Disruption of Bis Leads to the Deterioration of the Vascular Niche for Hematopoietic Stem Cells. Publication: Stem Cells 28.2 (2010): 268-278. |
Gene Name | Il7 interleukin 7 [ Mus musculus ] |
Official Symbol | Il7 |
Synonyms | IL7; interleukin 7; interleukin-7; Il-7; hlb368; A630026I06Rik; MGC129342 |
Gene ID | 16196 |
mRNA Refseq | NM_008371 |
Protein Refseq | NP_032397 |
UniProt ID | P10168 |
◆ Recombinant Proteins | ||
Il7-670R | Active Recombinant Rat Il7 | +Inquiry |
IL7-234I | Active Recombinant Human IL7 Protein, His-tagged | +Inquiry |
IL7-121H | Recombinant Human IL7 Protein, His-tagged | +Inquiry |
IL7-5333H | Recombinant Human Interleukin 7, HQ-tagged | +Inquiry |
IL7-232H | Recombinant Human IL7 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL7-5223HCL | Recombinant Human IL7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il7 Products
Required fields are marked with *
My Review for All Il7 Products
Required fields are marked with *
0
Inquiry Basket