Active Recombinant Mouse Il5 Protein

• Cat.No.: Il5-239I
• Product Overview: Recombinant Mouse Il5 Protein without tag was expressed in CHO.

Specification

• Species: Mouse
• Source: CHO
• Description: Interleukin-5 (IL-5), produced by mast cells, T cells and eosinophils, is responsible for the activities attributed to eosinophil differentiating factor, B cell growth factor II and T cell-replacing factor (TRF). It can increase production and mobilization of eosinophils and CD34+ progenitors from the bone marrow. IL-5 plays an important role in inducing cell-mediated immunity against parasitic infections and certain tumors. IL-5 also promotes differentiation of basophils and primes them for histamine and leukotriene release.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 0.5 ng/mL, measured in a cell proliferation assay using TF-1 cells, corresponding to a specific activity of > 2 × 10^6 units/mg.
• Molecular Mass: 25-40 kDa, observed by non-reducing SDS-PAGE.
• AA Sequence: MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant Murine Interlerkin 5 (IL-5) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmIL-5 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Il5 interleukin 5 [ Mus musculus ]
• Official Symbol: Il5
• Synonyms: IL5; interleukin 5; interleukin-5; TRF; BCGF-II; B-cell growth factor II; T-cell replacing factor; cytotoxic T-lymphocyte inducer; eosinophil differentiation factor; Il-5
• Gene ID: 16191
• mRNA Refseq: NM_010558
• Protein Refseq: NP_034688
• UniProt ID: P04401