Active Recombinant Mouse Il36g Protein, His-Tagged
Cat.No. : | Il36g-01M |
Product Overview : | Recombinant mouse Il36g Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | The expression of IL-36γ is high in psoriatic plaques and in tissues including epithelial cells. Signaling of IL-36γ through the IL-1Rrp2 receptor, which is mainly expressed on certain dendritic cells. The interaction between the IL-36 ligands and IL-1Rrp2 receptor trigger dendritic cell maturation and activation. IL-36γ also work as an agonist of NF-κB, consequently, stimulate the inflammatory response in bronchial epithelial cells. |
Form : | Lyophilized powder |
AA Sequence : | MGRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHP EPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Bio-activity : | Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is <15 ng/mL. The specific activity of recombinant mouse IL-36 gamma is > 6 x 10^4 IU/mg. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Notes : | Please use within one month after protein reconstitution. |
Gene Name | Il36g interleukin 36G [ Mus musculus (house mouse) ] |
Official Symbol | Il36g |
Synonyms | If36g; Il1f9; IL-36gamma |
Gene ID | 215257 |
mRNA Refseq | NM_153511.3 |
Protein Refseq | NP_705731.2 |
UniProt ID | Q3U0P4 |
◆ Recombinant Proteins | ||
IL36G-4844H | Recombinant Human IL36G protein, GST-tagged | +Inquiry |
Il36g-1309M | Recombinant Mouse Il36g protein, His-tagged | +Inquiry |
IL36G-5107H | Recombinant Human IL36G Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Il36g-176M | Recombinant Mouse Il36g Protein | +Inquiry |
Il36g-1865R | Recombinant Rat Il36g protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL36G-5235HCL | Recombinant Human IL1F9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il36g Products
Required fields are marked with *
My Review for All Il36g Products
Required fields are marked with *
0
Inquiry Basket