Active Recombinant Mouse Il3 Protein, His-tagged

• Cat.No.: Il3-7242M
• Product Overview: Recombinant mouse IL3, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques

Specification

• Species: Mouse
• Source: Insect Cells
• Tag: His
• Protein Length: 27-166
• Description: This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.
• Form: Liquid
• Bio-activity: Measured in a cell proliferation assay using TF-1 human erythroleukemic cell. The ED50 for this effects is less or equal to 0.1 ng/mL.
• Molecular Mass: 16.7 kDa
• AA Sequence: ASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVECLEHHHHHH
• Endotoxin: < 1.0 EU/μg of protein (determined by LAL method)
• Purity: > 90 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 0.25 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol.

Gene Information

• Gene Name: Il3 interleukin 3 [ Mus musculus (house mouse) ]
• Official Symbol: Il3
• Synonyms: Il3; interleukin 3; B; P; Il; BPA; PSF; Csfm; HCGF; Il-3; MCGF; Csfmu; interleukin-3; P-cell-stimulating factor; hematopoietic growth factor; mast cell growth factor; multipotential colony-stimulating factor
• Gene ID: 16187
• mRNA Refseq: NM_010556
• Protein Refseq: NP_034686
• UniProt ID: P01586