Active Recombinant Human IL3 Protein
Cat.No. : | IL3-246I |
Product Overview : | Recombinant Human IL3 Protein without tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Description : | Interleukin-3 (IL-3) is a hematopoietic growth factor that promotes the survival, differentiation and proliferation of committed progenitor cells of the megakaryocyte, granulocyte-macrophage, erythroid, eosinophil, basophil and mast cell lineages. Produced by T cells, mast cells and eosinophils, IL-3 enhances thrombopoieses, phagocytosis, and antibody-mediated cellular cytotoxicity. Its ability to activate monocytes suggests that IL-3 may have additional immunoregulatory roles. Many of the IL-3 activities depend upon co-stimulation with other cytokines. IL-3 is species-specific, variably glycosylated cytokine. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 0.1 ng/mL, measured in a cell proliferation assay using TF-1 cells, corresponding to a specific activity of > 1 × 10^7 units/mg. |
Molecular Mass : | 17-30 kDa, observed by non-reducing SDS-PAGE. |
AA Sequence : | APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant human Interlerkin 3 (IL-3) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhIL-3 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | IL3 interleukin 3 (colony-stimulating factor, multiple) [ Homo sapiens ] |
Official Symbol | IL3 |
Synonyms | IL3; interleukin 3 (colony-stimulating factor, multiple); interleukin-3; hematopoietic growth factor; IL 3; mast cell growth factor; MCGF; MGC79398; MGC79399; MULTI CSF; multilineage colony stimulating factor; P cell stimulating factor; mast-cell growth factor; P-cell stimulating factor; P-cell-stimulating factor; multilineage-colony-stimulating factor; multipotential colony-stimulating factor; IL-3; MULTI-CSF; |
Gene ID | 3562 |
mRNA Refseq | NM_000588 |
Protein Refseq | NP_000579 |
MIM | 147740 |
UniProt ID | P08700 |
◆ Recombinant Proteins | ||
IL3-88H | Recombinant Human GMCSF/IL-3 Fusion Protein | +Inquiry |
Il3-592M | Active Recombinant Mouse Interleukin 3 | +Inquiry |
IL3-120H | Active Recombinant Human Interleukin 3 (Colony-stimulating Factor, Multiple) | +Inquiry |
IL3-5192H | Recombinant Human IL3 Protein, GST-tagged | +Inquiry |
Il3-644M | Active Recombinant Mouse Il3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL3-607HCL | Recombinant Human IL3 cell lysate | +Inquiry |
IL3-445RCL | Recombinant Rat IL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL3 Products
Required fields are marked with *
My Review for All IL3 Products
Required fields are marked with *
0
Inquiry Basket